Recombinant Human Cystatin D, CSTD, CST5 (C-6His)

Contact us
Catalog number: C397
Price: Ask price €
Supplier: genways bulk
Product name: Recombinant Human Cystatin D, CSTD, CST5 (C-6His)
Quantity: bulk
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cystatin D is produced by our Mammalian expression system and the target gene encoding Gly21-Val142 is expressed with a 6His tag at the C-terminus
Molecular Weight: 14, 9 kD
UniProt number: P28325
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 5, 2 um filtered solution of 20 mM MES, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKVVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CST5 (C-6His), CSTD, Cystatin D
Short name: CST5 (C-6His), CSTD, Recombinant Cystatin D
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CST5 (C-6His), CSTD, sapiens Cystatin D, recombinant H
Alternative technique: rec
Identity: 2477
Gene: CST5 | More about : CST5
Long gene name: cystatin D
Locus: 20p11, 21
Discovery year: 1993-01-20
Entrez gene record: 1473
Pubmed identfication: 1939105
RefSeq identity: NM_001900
Classification: Cystatins, type 2
Havana BLAST/BLAT: OTTHUMG00000032089

Related Products :

C397 Recombinant Human Cystatin D, CSTD, CST5 (C-6His) 10 µg 202 € novo human
CC21 Recombinant Mouse Cathepsin D, CSTD (C-6His) 500 µg 1755 € novo mouse
RP-0525H Recombinant Human Cystatin D / CST5 Protein (His Tag) 10μg 624 € adv human
LV128903 CST5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV128904 CST5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV128905 CST5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV128906 CST5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV128908 CST5 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV128907 CST5 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
abx149680 Anti-CST5 Antibody 200 μg 369 € abbex human
abx913005 Anti-CST5 siRNA 15 nmol 528 € abbex human
C087 Recombinant Human Cystatin A (N-6His) 500 µg 1613 € novo human
CI55 Recombinant Human Cystatin C, CST3 (C-6His) 50 µg 496 € novo human
CE75 Recombinant Human Cystatin C, CST3 (N-6His) 1 mg 2283 € novo human
C334 Recombinant Human Cystatin F, CST7 (C-6His) 50 µg 496 € novo human
C333 Recombinant Human Cystatin M, CST6 (C-6His) 10 µg 202 € novo human
C335 Recombinant Human Cystatin S, CST4 (C-6His) 500 µg 1613 € novo human
C336 Recombinant Human Cystatin SA, CST2 (C-6His) 10 µg 202 € novo human
C462 Recombinant Human Cystatin SN, CST1 (C-6His) 1 mg 2283 € novo human
CR02 Recombinant Mouse Cystatin 8, CST8 (N-6His) 50 µg 496 € novo mouse
CD44 Recombinant Mouse Cystatin E, CST6 (C-6His) 10 µg 202 € novo mouse
CD20 Recombinant Mouse Cystatin F, CST7 (C-6His) 500 µg 1613 € novo mouse
CS25 Recombinant Human Cystatin C, CST3 (Human Cells) 500 µg 1755 € novo human
RP-970 Recombinant (E.Coli, GST tag) Human Cystatin-A/Stefin A 2 μg 405 € adi human
RP-0521H Recombinant Human Cystatin 7 / CST7 Protein 10μg 624 € adv human
RP-0522H Recombinant Human Cystatin 7 / CST7 Protein (Fc Tag) 10μg 624 € adv human
RP-0520H Recombinant Human Cystatin 7 / CST7 Protein (His Tag) 10μg 624 € adv human
GWB-BFEDC0 Recombinant Human Cystatin-B bulk Ask price € genways bulk human
RP-0523H Recombinant Human Cystatin B / CSTB Protein (His Tag) 50μg 624 € adv human
GWB-2E75DA Recombinant Human Cystatin C bulk Ask price € genways bulk human