Recombinant Mouse Cystatin F, CST7 (C-6His)

Contact us
Catalog number: CD20
Price: 332 €
Supplier: Bioss Primary Conjugated Antibodies.
Product name: Recombinant Mouse Cystatin F, CST7 (C-6His)
Quantity: 100ul
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Cystatin F is produced by our Mammalian expression system and the target gene encoding Ala19-Gln144 is expressed with a 6His tag at the C-terminus
Molecular Weight: 15, 4 kD
UniProt number: O89098
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: pH 8, 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAARHSVEKFNNCTNDIFLFKESHVSKALVQVVKGLKYMLEVKIGRTTCRKTMHHQLDNCDFQTNPALKRTLYCYSEVWVIPWLHSFEVPVLLCQVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CST7 (C-6His), Cystatin F
Short name: CST7 (C-6His), Recombinant Mouse Cystatin F
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CST7 (C-6His), recombinant Mouse Cystatin F
Alternative technique: rec
Identity: 2479
Gene: CST7 | More about : CST7
Long gene name: cystatin F
Synonyms gene name: cystatin F (leukocystatin)
Synonyms name: leukocystatin
Locus: 20p11, 21
Discovery year: 1998-10-14
GenBank acession: AF036342
Entrez gene record: 8530
Pubmed identfication: 9733783 9632704
RefSeq identity: NM_003650
Classification: Cystatins, type 2
Havana BLAST/BLAT: OTTHUMG00000032108

Related Products :

CD20 Recombinant Mouse Cystatin F, CST7 (C-6His) 500 µg 1613 € novo mouse
C334 Recombinant Human Cystatin F, CST7 (C-6His) 50 µg 496 € novo human
RP-1232M Recombinant Mouse Cystatin 7 / CST7 Protein (Fc Tag) 10μg 624 € adv mouse
RP-0521H Recombinant Human Cystatin 7 / CST7 Protein 10μg 624 € adv human
RP-0522H Recombinant Human Cystatin 7 / CST7 Protein (Fc Tag) 10μg 624 € adv human
RP-0520H Recombinant Human Cystatin 7 / CST7 Protein (His Tag) 10μg 624 € adv human
GENTAUR-58bc74a9aa516 Mouse Cystatin-F (Cst7) 100ug 1437 € MBS Recombinant Proteins mouse
GENTAUR-58bc74a9ed1d4 Mouse Cystatin-F (Cst7) 1000ug 1437 € MBS Recombinant Proteins mouse
GENTAUR-58bc74aa42202 Mouse Cystatin-F (Cst7) 100ug 1940 € MBS Recombinant Proteins mouse
GENTAUR-58bc74aa87407 Mouse Cystatin-F (Cst7) 1000ug 1940 € MBS Recombinant Proteins mouse
CR02 Recombinant Mouse Cystatin 8, CST8 (N-6His) 50 µg 496 € novo mouse
CD44 Recombinant Mouse Cystatin E, CST6 (C-6His) 10 µg 202 € novo mouse
C087 Recombinant Human Cystatin A (N-6His) 500 µg 1613 € novo human
CI55 Recombinant Human Cystatin C, CST3 (C-6His) 50 µg 496 € novo human
CE75 Recombinant Human Cystatin C, CST3 (N-6His) 1 mg 2283 € novo human
C397 Recombinant Human Cystatin D, CSTD, CST5 (C-6His) 10 µg 202 € novo human
C333 Recombinant Human Cystatin M, CST6 (C-6His) 10 µg 202 € novo human
C335 Recombinant Human Cystatin S, CST4 (C-6His) 500 µg 1613 € novo human
C336 Recombinant Human Cystatin SA, CST2 (C-6His) 10 µg 202 € novo human
C462 Recombinant Human Cystatin SN, CST1 (C-6His) 1 mg 2283 € novo human
GENTAUR-58bde8e6bfb5b Anti- CST7 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bde8e73b320 Anti- CST7 Antibody 0.06 ml 265 € MBS Polyclonals human
abx219392 Anti-CST7 Antibody inquire 50 € abbex human
GENTAUR-58be6429da31d Anti-CST7 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx913007 Anti-CST7 siRNA 30 nmol 717 € abbex human
abx913008 Anti-CST7 siRNA 30 nmol 717 € abbex human
bs-6039R-A350 CST7 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6039R-A488 CST7 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6039R-A555 CST7 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6039R-A594 CST7 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human