Recombinant Human Cystatin C, CST3 (N-6His)

Catalog number:	CE75 Buy Now
Price:	775 €
Supplier:	abbex
Product name:	Recombinant Human Cystatin C, CST3 (N-6His)
Quantity:	96 tests
Other quantities:	10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:	gene cst sapiens nhis technique

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Cystatin C is produced by our E, coli expression system and the target gene encoding Gly26-Ala146 is expressed with a 6His tag at the N-terminus
Molecular Weight:	16, 5 kD
UniProt number:	P01034
State of the product:	Freeze-dried
Shipping conditions:	Ambient temperature
Formulation:	150 mM sodium chloride, 2 um filtered solution of 20 mM HEPES, 4, Lyophilized from a 0, pH7
Storage recommendations:	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	MGSSHHHHHHSSGLVPRGSHMENLYFQGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	CST3 (N-6His), Cystatin C
Short name:	CST3 (N-6His), Recombinant Cystatin C
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	CST3 (N-6His), sapiens Cystatin C, recombinant H
Alternative technique:	rec
Identity:	2475
Gene:	CST3 | More about : CST3
Long gene name:	cystatin C
Synonyms gene name:	cystatin C (amyloid angiopathy and cerebral hemorrhage)
Locus:	20p11, 21
Discovery year:	1990-02-06
Entrez gene record:	1471
Pubmed identfication:	8486384
RefSeq identity:	NM_000099
Classification:	Cystatins, type 2
Havana BLAST/BLAT:	OTTHUMG00000032080

• #gene
• #cst
• #sapiens
• #nhis
• #technique