Recombinant Human Endothelial Cell Adhesion Molecule, ESAM (C-6His)

Contact us
Catalog number: C341
Price: 2575 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Endothelial Cell Adhesion Molecule, ESAM (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 121€ 50 µg 263€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are 
Molecular Weight: 24, 79 kD
UniProt number: Q96AP7
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ESAM (C-6His), Endothelial Adhesion Molecule
Short name: ESAM (C-6His), Recombinant Endothelial Cell Adhesion Molecule
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: endothelial cell adhesion molecule (C-6His), sapiens Endothelial cellular Adhesion Molecule, recombinant H
Alternative technique: rec
Alternative to gene target: BT, Cell surfaces, ESAM and IDBG-75276 and ENSG00000149564 and 90952, Esam and IDBG-150411 and ENSMUSG00000001946 and 69524, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005912 and adherens junction and cellular component this GO :0005923 and tight junction and cellular component this GO :0007156 and homophilic cell adhesion and biological process this GO :0007596 and blood coagulation and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016337 and single organismal cell-cell adhesion and biological process this GO :0050900 and leukocyte migration and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding, 54007 and IDBG-642621 and ENSBTAG00000001004 and 616926, endothelial cell adhesion molecule
Identity: 17474
Gene: ESAM | More about : ESAM
Long gene name: endothelial cell adhesion molecule
Synonyms: W117m
Locus: 11q24, 2
Discovery year: 2003-11-26
GenBank acession: AK075396
Entrez gene record: 90952
Pubmed identfication: 11279107 11906820
RefSeq identity: NM_138961
Classification: Immunoglobulin like domain containing V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000151986

Related Products :

C341 Recombinant Human Endothelial Cell Adhesion Molecule, ESAM (C-6His) 50 µg 263 € novo human
CD29 Recombinant Human Endothelial Cell Adhesion Molecule, ESAM (C-Fc) 10 µg 146 € novo human
RP-0660H Recombinant Human ESAM / Endothelial Cell Adhesion Molecule Protein 50μg 624 € adv human
RP-0659H Recombinant Human ESAM / Endothelial Cell Adhesion Molecule Protein (Fc Tag) 50μg 624 € adv human
RP-0658H Recombinant Human ESAM / Endothelial Cell Adhesion Molecule Protein (His Tag) 50μg 624 € adv human
RP-1275M Recombinant Mouse ESAM / Endothelial Cell Adhesion Molecule Protein (His Tag) 50μg 624 € adv mouse
RP-2128R Recombinant Rat ESAM / Endothelial Cell Adhesion Molecule Protein (Fc Tag) 50μg 624 € adv rat
DL-ESAM-Hu Human Endothelial Cell Adhesion Molecule ESAM ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bdc7b67464f Anti- Endothelial Cell Adhesion Molecule (ESAM) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc9e8a1660 Anti- Endothelial Cell Adhesion Molecule (ESAM) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc9e8f35a5 Anti- Endothelial Cell Adhesion Molecule (ESAM) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcaaa9f0fe Anti- Endothelial Cell Adhesion Molecule (ESAM) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdcaab087bd Anti- Endothelial Cell Adhesion Molecule (ESAM) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdce91e48c1 Anti- Endothelial Cell Adhesion Molecule (ESAM) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bddcb2104e6 Anti- Endothelial Cell Adhesion Molecule (ESAM) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bddcf496c3d Anti- Endothelial Cell Adhesion Molecule (ESAM) Antibody 100ug 575 € MBS Polyclonals human
EKU03882 Endothelial Cell Adhesion Molecule (ESAM) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
GENTAUR-58bdaa29d2566 Mouse Endothelial cell-selective adhesion molecule (Esam) 100ug 1669 € MBS Recombinant Proteins mouse
GENTAUR-58bdaa2a29e0f Mouse Endothelial cell-selective adhesion molecule (Esam) 1000ug 1669 € MBS Recombinant Proteins mouse
GENTAUR-58bdaa2a7b17d Mouse Endothelial cell-selective adhesion molecule (Esam) 100ug 2183 € MBS Recombinant Proteins mouse
GENTAUR-58bdaa2acc47c Mouse Endothelial cell-selective adhesion molecule (Esam) 1000ug 2183 € MBS Recombinant Proteins mouse
CS74 Recombinant Human Platelet Endothelial Cell Adhesion Molecule, PECAM-1, CD31 (C-6His) 50 µg 202 € novo human
abx167594 Anti-Endothelial Cell Adhesion Molecule Protein (Recombinant) 50 μg 615 € abbex human
C435 Recombinant Human Cell Adhesion Molecule 3, CADM3, IGSF4B, SynCAM3 (C-6His) 500 µg 1613 € novo human
C522 Recombinant Human Hepatocyte Cell Adhesion Molecule, HepaCAM (C-6His) 10 µg 202 € novo human
CP45 Recombinant Human Neural Cell Adhesion Molecule 1, NCAM-1, CD56 (C-6His) 1 mg 2283 € novo human
CM49 Recombinant Mouse Endothelial Cell-Specific Molecule , Endocan, ESM-1 (C-6His) 10 µg 126 € novo mouse
abx250160 Anti-Human Platelet/Endothelial Cell Adhesion Molecule 1 ELISA Kit 96 tests 557 € abbex human
AE28057HU-48 ELISA test for Human Platelet endothelial cell adhesion molecule (PECAM1) 1x plate of 48 wells 373 € abebio human
GENTAUR-58bc4f11b2223 Human Platelet endothelial cell adhesion molecule (PECAM1) 100ug 2575 € MBS Recombinant Proteins human