| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Programmed Cell Death 1 Ligand 1 is produced by our Mammalian expression system and the target gene encoding Phe19-Thr239 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
26, 33 kD |
| UniProt number: |
Q9NZQ7 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 5% Trehalose, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
B7-H1, CD274 (C-6His), PD-L1 |
| Short name: |
B7-H1, CD274 (C-6His), Recombinant PD-L1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
B7-H1, CD274 molecule (C-6His), sapiens PD-L1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD274 and IDBG-47487 and ENSG00000120217 and 29126, Cd274 and IDBG-157249 and ENSMUSG00000016496 and 60533, Cell surfaces, PD-L1 and IDBG-631351 and ENSBTAG00000000095 and 533834, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0012505 and endomembrane system and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0031295 and T cell costimulation and biological process this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :2001181 and positive regulation of interleukin-10 secretion and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD274 molecule |
| Identity: |
17635 |
| Gene: |
CD274 |
More about : CD274 |
| Long gene name: |
CD274 molecule |
| Synonyms gene: |
PDCD1LG1 |
| Synonyms gene name: |
programmed cell death 1 ligand 1 CD274 antigen |
| Synonyms: |
B7-H B7H1 PD-L1 PDL1 B7-H1 |
| Synonyms name: |
B7 homolog 1 |
| Locus: |
9p24, 1 |
| Discovery year: |
2003-11-13 |
| GenBank acession: |
AF177937 |
| Entrez gene record: |
29126 |
| Pubmed identfication: |
11015443 10581077 |
| RefSeq identity: |
NM_014143 |
| Classification: |
Endogenous ligands C2-set domain containing CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000019503 |