Recombinant Human PD-L1, B7-H1, CD274 (C-6His)

Contact us
Catalog number: C315
Price: 278 €
Supplier: accurate-monoclonals
Product name: Recombinant Human PD-L1, B7-H1, CD274 (C-6His)
Quantity: 0.1 mg
Other quantities: 1 mg 1166€ 10 µg 90€ 50 µg 171€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Programmed Cell Death 1 Ligand 1 is produced by our Mammalian expression system and the target gene encoding Phe19-Thr239 is expressed with a 6His tag at the C-terminus
Molecular Weight: 26, 33 kD
UniProt number: Q9NZQ7
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 5% Trehalose, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: B7-H1, CD274 (C-6His), PD-L1
Short name: B7-H1, CD274 (C-6His), Recombinant PD-L1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: B7-H1, CD274 molecule (C-6His), sapiens PD-L1, recombinant H
Alternative technique: rec
Alternative to gene target: CD274 and IDBG-47487 and ENSG00000120217 and 29126, Cd274 and IDBG-157249 and ENSMUSG00000016496 and 60533, Cell surfaces, PD-L1 and IDBG-631351 and ENSBTAG00000000095 and 533834, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0012505 and endomembrane system and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0031295 and T cell costimulation and biological process this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :2001181 and positive regulation of interleukin-10 secretion and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD274 molecule
Identity: 17635
Gene: CD274 | More about : CD274
Long gene name: CD274 molecule
Synonyms gene: PDCD1LG1
Synonyms gene name: programmed cell death 1 ligand 1 CD274 antigen
Synonyms: B7-H B7H1 PD-L1 PDL1 B7-H1
Synonyms name: B7 homolog 1
Locus: 9p24, 1
Discovery year: 2003-11-13
GenBank acession: AF177937
Entrez gene record: 29126
Pubmed identfication: 11015443 10581077
RefSeq identity: NM_014143
Classification: Endogenous ligands C2-set domain containing CD molecules V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000019503

Related Products :

C315 Recombinant Human PD-L1, B7-H1, CD274 (C-6His) 50 µg 171 € novo human
CJ88 Recombinant Mouse PD-L1, B7-H1, CD274 (C-6His) 1 mg 1115 € novo mouse
CM33 Recombinant Human PD-L1, B7-H1, CD274 (C-Flag) 1 mg 1674 € novo human
CM06 Recombinant Human PD-L1, B7-H1, CD274 (C-mFc) 500 µg 1186 € novo human
RP-1195H Recombinant Human PD-L1 / B7-H1 / CD274 Protein (ECD, Fc Tag) 20μg 346 € adv human
RP-1193H Recombinant Human PD-L1 / B7-H1 / CD274 Protein (Fc Tag) 100μg 624 € adv human
RP-1194H Recombinant Human PD-L1 / B7-H1 / CD274 Protein (His Tag) 100μg 624 € adv human
abx261703 Anti-CD274 Protein (Recombinant) 20 µg 340 € abbex human
abx263458 Anti-CD274 Protein (Recombinant) 100 µg 1674 € abbex human
GWB-P0495A CD274, 19-238aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-P0393C CD274, 19-239aa, Recombinant Protein bulk Ask price € genways bulk human
RP-1040RC Recombinant Cynomolgus PD-L1 / B7-H1 / CD274 Protein (Fc Tag) 100μg 659 € adv human
CJ89 Recombinant Mouse PD-L1, B7-H1, CD274 (C-Fc) 50 µg 156 € novo mouse
RP-1442M Recombinant Mouse PD-L1 / B7-H1 / CD274 Protein (His & Fc Tag) 100μg 624 € adv mouse
RP-1441M Recombinant Mouse PD-L1 / B7-H1 / CD274 Protein (His Tag) 100μg 624 € adv mouse
RP-1041RC Recombinant Rhesus PD-L1 / B7-H1 / CD274 Protein (His Tag) 100μg 659 € adv rhesus
MBS240449 Anti-Human B7-H1 / PD-L1 / CD274 50ug 597 € MBS Polyclonals_1 human
MBS248073 Anti-Human B7-H1 / PD-L1 / CD274 Antibody 200ul 597 € MBS Polyclonals_1 human
MBS224074 Anti-HUMAN CD274 100ug 442 € MBS Polyclonals_1 human
MBS301739 Anti-Human CD274/B7-H1 PAb 1 mililiter 542 € MBS Polyclonals_1 human
MBS301741 Anti-Human CD274/B7-H1 PAb 100ul 232 € MBS Polyclonals_1 human
MBS302274 Anti-Human CD274/B7-H1 PAb 500ul 387 € MBS Polyclonals_1 human
GWB-31E71B B7-H1 protein (CD274) Rabbit antibody to or anti-Human Polyclonal (Internal) antibody 1 x 1 vial 602 € genways human
LV113085 CD274 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV113086 CD274 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 517 € ABM lentivectors human
LV113087 CD274 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV113088 CD274 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV113090 CD274 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV113089 CD274 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 517 € ABM lentivectors human
YSRTMCA2627GA CD274, Mouse Monoclonal antibody-Human; Clone: MIH2, flow 0.1 mg 278 € accurate-monoclonals human