Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase-Like 1, PPIase, PPIL1(N-6His)

Contact us
Catalog number: C291
Price: 1542 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase-Like 1, PPIase, PPIL1(N-6His)
Quantity: 100ug
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human PPIase is produced by our E, coli expression system and the target gene encoding Met1-Gly166 is expressed with a 6His tag at the N-terminus
Molecular Weight: 20, 4 kD
UniProt number: Q9Y3C6
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PPIL1(N-6His), PPIase, Peptidyl-Prolyl Cis-Trans Isomerase-Like 1
Short name: PPIL1(N-6His), PPIase, Recombinant Peptidyl-Prolyl Cis-Trans Isomerase-Like 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PPIL1(N-6His), PPIase, sapiens Peptidyl-Prolyl Cis-Trans Isomerase-Like 1, recombinant H
Alternative technique: rec
Identity: 9260
Gene: PPIL1 | More about : PPIL1
Long gene name: peptidylprolyl isomerase like 1
Synonyms gene name: peptidylprolyl isomerase (cyclophilin)-like 1
Synonyms: CYPL1
Synonyms name: cyclophilin like 1
Locus: 6p21, 2
Discovery year: 1995-09-05
GenBank acession: AF090992
Entrez gene record: 51645
Pubmed identfication: 10072585 8978786
Classification: Cyclophilin peptidylprolyl isomerases
Havana BLAST/BLAT: OTTHUMG00000014612

Related Products :

C291 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase-Like 1, PPIase, PPIL1(N-6His) 500 µg 1613 € novo human
CE96 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase D, PPID, PPIase D (N, C-6His) 500 µg 1613 € novo human
AP55142SU-N anti-Peptidyl-prolyl cis-trans isomerase A (PPIA/PPIase 1) Antibody 0,2 ml 630 € acr human
MBS624484 FKBP14, NT (FK506-binding Protein 14, Peptidyl-prolyl Cis-trans Isomerase FKBP14, PPIase FKBP14, Rotamase, 22kD FK506-binding Protein, 22kD FKBP, FKBP-2, FKBP-22, FKBP22, FKBP-14, UNQ322/PRO381) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623609 FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52) Antibody 200ul 603 € MBS Polyclonals_1 human
CC56 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP2, FKBP22, FKBP13 (C-6His) 10 µg 156 € novo human
CH60 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP3 (N-6His) 50 µg 156 € novo human
CG71 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP4, FKBP4 (C-6His) 10 µg 95 € novo human
CA33 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP7, FKBP7 (C-6His) 10 µg 202 € novo human
C253 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase H, PPIH (N-6His) 10 µg 202 € novo human
RP-412 Recombinant (E.Coli) Human Peptidyl-Prolyl Cis/Trans Isomerase 5 μg 188 € adi human
CR15 Recombinant Human Peptidyl-prolyl Cis-trans Isomerase A, Cyclophilin A, CYPA 1 mg 1014 € novo human
CR16 Recombinant Mouse Peptidyl-prolyl Cis-trans Isomerase A, Cyclophilin A, CYPA 500 µg 659 € novo mouse
GENTAUR-58bd6d4c127ce Bovine Peptidyl-prolyl cis-trans isomerase-like 1 (PPIL1) 100ug 1536 € MBS Recombinant Proteins bovine
GENTAUR-58bd6d4c6d37d Bovine Peptidyl-prolyl cis-trans isomerase-like 1 (PPIL1) 1000ug 1536 € MBS Recombinant Proteins bovine
GENTAUR-58bd6d4cc29ea Bovine Peptidyl-prolyl cis-trans isomerase-like 1 (PPIL1) 100ug 2039 € MBS Recombinant Proteins bovine
GENTAUR-58bd6d4d183b2 Bovine Peptidyl-prolyl cis-trans isomerase-like 1 (PPIL1) 1000ug 2039 € MBS Recombinant Proteins bovine
GENTAUR-58bd6084d0807 Chicken Peptidyl-prolyl cis-trans isomerase-like 3 (PPIL3) 100ug 1525 € MBS Recombinant Proteins chicken
GENTAUR-58bd60852d6cc Chicken Peptidyl-prolyl cis-trans isomerase-like 3 (PPIL3) 1000ug 1525 € MBS Recombinant Proteins chicken
GENTAUR-58bd608560fe1 Chicken Peptidyl-prolyl cis-trans isomerase-like 3 (PPIL3) 100ug 2028 € MBS Recombinant Proteins chicken
GENTAUR-58bd6085c6ba6 Chicken Peptidyl-prolyl cis-trans isomerase-like 3 (PPIL3) 1000ug 2028 € MBS Recombinant Proteins chicken
GENTAUR-58baa6a6b5789 Cryptococcus neoformans var. neoformans serotype D Peptidyl-prolyl cis-trans isomerase-like 1 (CYP1) 100ug 1558 € MBS Recombinant Proteins human
GENTAUR-58baa6a7106cc Cryptococcus neoformans var. neoformans serotype D Peptidyl-prolyl cis-trans isomerase-like 1 (CYP1) 1000ug 1558 € MBS Recombinant Proteins human
GENTAUR-58baa6a78a7f9 Cryptococcus neoformans var. neoformans serotype D Peptidyl-prolyl cis-trans isomerase-like 1 (CYP1) 100ug 2061 € MBS Recombinant Proteins human
GENTAUR-58baa6a845a39 Cryptococcus neoformans var. neoformans serotype D Peptidyl-prolyl cis-trans isomerase-like 1 (CYP1) 1000ug 2061 € MBS Recombinant Proteins human
GENTAUR-58bab6ae60c5f Cryptococcus neoformans var. neoformans serotype D Peptidyl-prolyl cis-trans isomerase-like 1 (CYP1) 100ug 1558 € MBS Recombinant Proteins human
GENTAUR-58bab6aedd3bf Cryptococcus neoformans var. neoformans serotype D Peptidyl-prolyl cis-trans isomerase-like 1 (CYP1) 1000ug 1558 € MBS Recombinant Proteins human
GENTAUR-58bab6af69e8f Cryptococcus neoformans var. neoformans serotype D Peptidyl-prolyl cis-trans isomerase-like 1 (CYP1) 100ug 2061 € MBS Recombinant Proteins human
GENTAUR-58bab6b01ac96 Cryptococcus neoformans var. neoformans serotype D Peptidyl-prolyl cis-trans isomerase-like 1 (CYP1) 1000ug 2061 € MBS Recombinant Proteins human
GENTAUR-58b86c18c3960 Cryptococcus neoformans var. neoformans serotype D Peptidyl-prolyl cis-trans isomerase-like 3 (CYP10) 100ug 1542 € MBS Recombinant Proteins human