Recombinant Human TERF1-Interacting Telomerase Inhibitor 1, PIN2, PINX1 (N-6His)

Contact us
Catalog number: C287
Price: 347 €
Supplier: acr
Product name: Recombinant Human TERF1-Interacting Telomerase Inhibitor 1, PIN2, PINX1 (N-6His)
Quantity: 50 Вµg
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Not all receptor antagonist that bind to enzymes are inhibitors, Since blocking an enzyme's activity can kill a pathogen , activator, caspase, esterase inhibitors , lipoprotein, many drugs are enzyme inhibitors, papain, pathway, peptidase, protease , proteinase, trypsin, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme,  , Tissue, acrosin, activity, and decreases its , are , bind to enzymes and increase their , enzymatic activity, enzyme activator ligands or agonists , enzyme receptor , imbalance, metabolic , or correct a , or receptor ligands or receptor antagonists that bind to an , proteins 
Molecular Weight: 2 kD, 39
UniProt number: Q96BK5
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM DTT, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKINKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PIN2, PINX1 (N-6His), TERF1-Interacting Telomerase Inhibitor 1
Short name: PIN2, PINX1 (N-6His), Recombinant TERF1-Interacting Telomerase Inhibitor 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PIN2, PINX1 (N-6His), sapiens telomeric repeat binding factor (NIMA-interacting) 1-Interacting Telomerase suppressor 1, recombinant H
Alternative technique: rec
Alternative to gene target: BT, DNA binding, TERF1 and IDBG-25349 and ENSG00000147601 and 7013, Terf1 and IDBG-134893 and ENSMUSG00000025925 and 21749, bending, bending and also this GO :0042162 : telomeric DNA binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046982 : protein heterodimerization activity, bending and molecular function this GO :0010834 and telomere maintenance via telomere shortening and biological process this GO :0031116 and positive regulation of microtubule polymerization and biological process this GO :0032211 and negative regulation of telomere maintenance via telomerase and biological process this GO :0032214 and negative regulation of telomere maintenance via semi-conservative replication and biological process this GO :0042162 and telomeric DNA binding and molecular function this GO :0042493 and response to drug and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0045931 and positive regulation of mitotic cell cycle and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0051260 and protein homooli this GO merization and biological process this GO :0051974 and negative regulation of telomerase activity and biological process, hTRF1-AS and PIN2 and t-TRF1 and TRBF1 and TRF and TRF1, nuclei, telomeric region and cellular component this GO :0000783 and nuclear telomere cap complex and cellular component this GO :0000784 and nuclear chromosome, telomeric region and cellular component this GO :0001309 and age-dependent telomere shortening and biological process this GO :0003677 and DNA binding and molecular function this GO :0003682 and chromatin binding and molecular function this GO :0003691 and double-stranded telomeric DNA binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005819 and spindle and cellular component this GO :0007004 and telomere maintenance via telomerase and biological process this GO :0007067 and mitotic nuclear division and biological process this GO :0007094 and mitotic spindle assembly checkpoint and biological process this GO :0008017 and microtubule binding and molecular function this GO :0008156 and negative regulation of DNA replication and biological process this GO :0008301 and DNA binding, this GO :0000086 and G2/M transition of mitotic cell cycle and biological process this GO :0000723 and telomere maintenance and biological process this GO :0000781 and chromosome, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0003682 : chromatin binding and also this GO :0003691 : double-stranded telomeric DNA binding and also this GO :0005515 : protein binding and also this GO :0008017 : microtubule binding and also this GO :0008301 : DNA binding, this GO :0003682 : chromatin binding, this GO :0003691 : double-stranded telomeric DNA binding, this GO :0005515 : protein binding, this GO :0008017 : microtubule binding, this GO :0008301 : DNA binding, this GO :0042162 : telomeric DNA binding, this GO :0042803 : protein homodimerization activity, this GO :0046982 : protein heterodimerization activity, 23286 and IDBG-644763 and ENSBTAG00000032982 and 519474, telomeric repeat binding factor (NIMA-interacting) 1
Identity: 11728
Gene: TERF1 | More about : TERF1
Long gene name: telomeric repeat binding factor 1
Synonyms gene: TRBF1
Synonyms gene name: telomeric repeat binding factor (NIMA-interacting) 1
Synonyms: PIN2 TRF1 TRF
Locus: 8q21, 11
Discovery year: 1997-11-20
GenBank acession: U74382
Entrez gene record: 7013
Pubmed identfication: 9391075
RefSeq identity: NM_017489
Classification: Shelterin complex Myb/SANT domain containing
Havana BLAST/BLAT: OTTHUMG00000164522

Related Products :

C287 Recombinant Human TERF1-Interacting Telomerase Inhibitor 1, PIN2, PINX1 (N-6His) 500 µg 1613 € novo human
GENTAUR-58b8782f0e422 Rat PIN2/TERF1-interacting telomerase inhibitor 1 (Pinx1) 100ug 1951 € MBS Recombinant Proteins rat
GENTAUR-58b8782f6869e Rat PIN2/TERF1-interacting telomerase inhibitor 1 (Pinx1) 1000ug 1951 € MBS Recombinant Proteins rat
GENTAUR-58b8782fac575 Rat PIN2/TERF1-interacting telomerase inhibitor 1 (Pinx1) 100ug 2464 € MBS Recombinant Proteins rat
GENTAUR-58b8783028e4f Rat PIN2/TERF1-interacting telomerase inhibitor 1 (Pinx1) 1000ug 2464 € MBS Recombinant Proteins rat
MBS624432 TERT, ID (Telomerase Reverse Transcriptase, Telomerase Catalytic Subunit, HEST2, Telomerase-associated Protein 2, TP2, EST2, TCS1, TRT) Antibody 200ul 597 € MBS Polyclonals_1 human
MBS624540 TERT, phosphorylated (Tyr707) (Telomerase Reverse Transcriptase, Telomerase Catalytic Subunit, HEST2, Telomerase-associated Protein 2, TP2, EST2, TCS1, TRT) 200ul 603 € MBS Polyclonals_1 human
MBS420396 Goat anti-TERF1 / PIN2 Antibody 100ug 370 € MBS Polyclonals_1 human
GWB-FA8D6F Recombinant Human PIN2-Interacting Protein 1 bulk Ask price € genways bulk human
abx262131 Anti-PIN2-Interacting Protein 1 Protein (Recombinant) 5 µg 238 € abbex human
MBS619332 RIP3 (Receptor Interacting Protein 3, Receptor-interacting Protein 3, RIP-3, Receptor-interacting Serine/threonine Kinase 3, Receptor-interacting Serine/threonine-protein Kinase 3, RIP-like Protein Kinase 3, RIPK3) 100ug 857 € MBS Polyclonals_1 human
DL-TINF2-Hu Human TERF1 Interacting Nuclear Factor 2 TINF2 ELISA Kit 96T 974 € DL elisas human
EKU07598 TERF1 Interacting Nuclear Factor 2 (TINF2) ELISA kit 1 plate of 96 wells 899 € Biomatik ELISA kits human
MBS617707 JIP 1/2, SH3 (C-Jun-amino-terminal Kinase-interacting Protein 1, JNK-interacting Protein 1, JIP1, JIP-1, C-Jun-amino-terminal Kinase-interacting Protein 2, JNK-interacting Protein 2, JIP2, JIP-2, Islet-brain 1, IB1, IB-1, Islet-brain-2, IB2, IB-2, JNK MAP Antibody 100ug 663 € MBS Polyclonals_1 human
MBS617274 Lck Interacting Molecule (LIME, dJ583P15.4, FLJ20406, Lck Interacting Membrane Protein, Lck Interacting Transmembrane Adaptor 1, LIME1, LP8067, RP4 583P15.5) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS612715 MIZF (MBD2 Interacting Zinc Finger Protein, Methyl CpG Binding Protein 2 Interacting Zinc Finger Protein, MBD2 (Methyl-CpG-Binding Protein)-Interacting Zinc Finger Protein) Antibody 200ul 558 € MBS Polyclonals_1 human
MBS621815 SNIP1 (Smad Nuclear Interacting Protein 1 (Smad Nuclear Interacting), Smad Nuclear-interacting Protein, dJ423B22.2, FLJ12553, RP3-423B22.3, Splicing Factor Arginine/serine Rich 4 (Pre mRNA Splicing Factor SRP75)) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS619579 STK35 (Serine/threonine Protein Kinase 35, Clik1, CLP 36 Interacting Kinase, CLP-36-interacting Kinase, EC 2.7.1.37, PDLIM1-interacting Kinase 1) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS623297 WIPF1 (WAS/WASL interacting protein family, Member 1, MGC111041, PRPL-2, PRPL-2 protein, WAS/WASL interacting protein family member 1, WASP-interacting protein, WASPIP, WIP, Wiskott-Aldrich syndrome protein interacting protein, Wiskott-Aldrich syndrome pr Antibody 100ug 591 € MBS Polyclonals_1 human
GWB-P1727K PINX1, 1-328aa, Recombinant Protein bulk Ask price € genways bulk human
MBS623132 PIAS2 (Protein inhibitor of activated STAT, 2 Androgen, receptor-interacting protein 3, ARIP3, DAB2-interacting protein, DIP, E3 SUMO-protein ligase PIAS2, MGC102682, miz, Miz1, MIZ1, Msx-interacting zinc finger protein, PIAS-NY protein, PIASX, PIASX-ALPH 100ug 774 € MBS Polyclonals_1 human
RP-1487H Recombinant Human TERF1 / TRF1 Protein (His Tag) 20μg 572 € adv human
LV263005 PINX1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
CD51 Recombinant Human PI3K-Interacting Protein 1, PIK3IP1 (C-6His) 1 mg 2283 € novo human
CF17 Recombinant Human T Cell Receptor Interacting Molecule, TRIM, TCRIM, TRAT1 (C-6His) 50 µg 496 € novo human
CE59 Recombinant Human Toll-Interacting Protein, TOLLIP (C-6His) 10 µg 202 € novo human
AR09191PU-L anti-PINX1 (1-328, His-tag) Antibody 0,5 mg 1500 € acr human
AR09191PU-N anti-PINX1 (1-328, His-tag) Antibody 0,1 mg 587 € acr human
AP10037PU-N anti-PINX1 (225-237) Antibody 0,1 mg 558 € acr human
C11479-1 anti-PINX1 Antibody 50 Вµg 347 € acr human