| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Not all receptor antagonist that bind to enzymes are inhibitors, Since blocking an enzyme's activity can kill a pathogen , activator, caspase, esterase inhibitors , lipoprotein, many drugs are enzyme inhibitors, papain, pathway, peptidase, protease , proteinase, trypsin, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme, , Tissue, acrosin, activity, and decreases its , are , bind to enzymes and increase their , enzymatic activity, enzyme activator ligands or agonists , enzyme receptor , imbalance, metabolic , or correct a , or receptor ligands or receptor antagonists that bind to an , proteins |
| Molecular Weight: |
2 kD, 39 |
| UniProt number: |
Q96BK5 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
1 mM DTT, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKINKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
PIN2, PINX1 (N-6His), TERF1-Interacting Telomerase Inhibitor 1 |
| Short name: |
PIN2, PINX1 (N-6His), Recombinant TERF1-Interacting Telomerase Inhibitor 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
PIN2, PINX1 (N-6His), sapiens telomeric repeat binding factor (NIMA-interacting) 1-Interacting Telomerase suppressor 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, DNA binding, TERF1 and IDBG-25349 and ENSG00000147601 and 7013, Terf1 and IDBG-134893 and ENSMUSG00000025925 and 21749, bending, bending and also this GO :0042162 : telomeric DNA binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046982 : protein heterodimerization activity, bending and molecular function this GO :0010834 and telomere maintenance via telomere shortening and biological process this GO :0031116 and positive regulation of microtubule polymerization and biological process this GO :0032211 and negative regulation of telomere maintenance via telomerase and biological process this GO :0032214 and negative regulation of telomere maintenance via semi-conservative replication and biological process this GO :0042162 and telomeric DNA binding and molecular function this GO :0042493 and response to drug and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0045931 and positive regulation of mitotic cell cycle and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0051260 and protein homooli this GO merization and biological process this GO :0051974 and negative regulation of telomerase activity and biological process, hTRF1-AS and PIN2 and t-TRF1 and TRBF1 and TRF and TRF1, nuclei, telomeric region and cellular component this GO :0000783 and nuclear telomere cap complex and cellular component this GO :0000784 and nuclear chromosome, telomeric region and cellular component this GO :0001309 and age-dependent telomere shortening and biological process this GO :0003677 and DNA binding and molecular function this GO :0003682 and chromatin binding and molecular function this GO :0003691 and double-stranded telomeric DNA binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005819 and spindle and cellular component this GO :0007004 and telomere maintenance via telomerase and biological process this GO :0007067 and mitotic nuclear division and biological process this GO :0007094 and mitotic spindle assembly checkpoint and biological process this GO :0008017 and microtubule binding and molecular function this GO :0008156 and negative regulation of DNA replication and biological process this GO :0008301 and DNA binding, this GO :0000086 and G2/M transition of mitotic cell cycle and biological process this GO :0000723 and telomere maintenance and biological process this GO :0000781 and chromosome, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0003682 : chromatin binding and also this GO :0003691 : double-stranded telomeric DNA binding and also this GO :0005515 : protein binding and also this GO :0008017 : microtubule binding and also this GO :0008301 : DNA binding, this GO :0003682 : chromatin binding, this GO :0003691 : double-stranded telomeric DNA binding, this GO :0005515 : protein binding, this GO :0008017 : microtubule binding, this GO :0008301 : DNA binding, this GO :0042162 : telomeric DNA binding, this GO :0042803 : protein homodimerization activity, this GO :0046982 : protein heterodimerization activity, 23286 and IDBG-644763 and ENSBTAG00000032982 and 519474, telomeric repeat binding factor (NIMA-interacting) 1 |
| Identity: |
11728 |
| Gene: |
TERF1 |
More about : TERF1 |
| Long gene name: |
telomeric repeat binding factor 1 |
| Synonyms gene: |
TRBF1 |
| Synonyms gene name: |
telomeric repeat binding factor (NIMA-interacting) 1 |
| Synonyms: |
PIN2 TRF1 TRF |
| Locus: |
8q21, 11 |
| Discovery year: |
1997-11-20 |
| GenBank acession: |
U74382 |
| Entrez gene record: |
7013 |
| Pubmed identfication: |
9391075 |
| RefSeq identity: |
NM_017489 |
| Classification: |
Shelterin complex Myb/SANT domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000164522 |