| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human PPIase H is produced by our E, coli expression system and the target gene encoding Met1-Met177 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
21, 4 kD |
| UniProt number: |
O43447 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
PPIH (N-6His), Peptidyl-Prolyl Cis-Trans Isomerase H |
| Short name: |
PPIH (N-6His), Recombinant Peptidyl-Prolyl Cis-Trans Isomerase H |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
peptidylprolyl isomerase H (cyclophilin H) (N-6His), sapiens Peptidyl-Prolyl Cis-Trans Isomerase H, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
PPIH and IDBG-640563 and ENSBTAG00000004590 and 513428, PPIH and IDBG-97224 and ENSG00000171960 and 10465, Ppih and IDBG-182988 and ENSMUSG00000060288 and 433064, nuclei, ribonucleoprotein complex binding, this GO :0000398 and mRNA splicing, this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity, this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity and also this GO :0005515 : protein binding and also this GO :0016018 : cyclosporin A binding and also this GO :0043021 : ribonucleoprotein complex binding, this GO :0005515 : protein binding, this GO :0016018 : cyclosporin A binding, this GO :0043021 : ribonucleoprotein complex binding, via spliceosome and biological process this GO :0000413 and protein peptidyl-prolyl isomerization and biological process this GO :0003755 and peptidyl-prolyl cis-trans isomerase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005681 and spliceosomal complex and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006457 and protein folding and biological process this GO :0006461 and protein complex assembly and biological process this GO :0016018 and cyclosporin A binding and molecular function this GO :0016607 and nuclear speck and cellular component this GO :0043021 and ribonucleoprotein complex binding and molecular function this GO :0045070 and positive regulation of viral genome replication and biological process this GO :0046540 and U4/U6 x U5 tri-snRNP complex and cellular component this GO :0071001 and U4/U6 snRNP and cellular component, 66101, peptidylprolyl isomerase H (cyclophilin H) |
| Identity: |
14651 |
| Gene: |
PPIH |
More about : PPIH |
| Long gene name: |
peptidylprolyl isomerase H |
| Synonyms gene name: |
peptidyl prolyl isomerase H (cyclophilin H) |
| Synonyms: |
USA-CYP CYP-20 SnuCyp-20 CYPH MGC5016 |
| Synonyms name: |
USA-CyP SnuCyp-20 cyclophilin H U-snRNP-associated cyclophilin SunCyp-20 small nuclear ribonucleoprotein particle-specific cyclophilin H rotamase H peptidyl-prolyl cis-trans isomerase H PPIase h |
| Locus: |
1p34, 2 |
| Discovery year: |
2001-03-16 |
| GenBank acession: |
AF016371 |
| Entrez gene record: |
10465 |
| Pubmed identfication: |
9404889 9570313 |
| RefSeq identity: |
NM_006347 |
| Classification: |
Cyclophilin peptidylprolyl isomerases |
| Havana BLAST/BLAT: |
OTTHUMG00000007520 |