| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Not all receptor antagonist that bind to enzymes are inhibitors, Since blocking an enzyme's activity can kill a pathogen , activator, caspase, esterase inhibitors , lipoprotein, many drugs are enzyme inhibitors, papain, pathway, peptidase, protease , proteinase, trypsin, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme,  , Tissue, acrosin, activity, and decreases its , are , bind to enzymes and increase their , enzymatic activity, enzyme activator ligands or agonists , enzyme receptor , imbalance, metabolic , or correct a , or receptor ligands or receptor antagonists that bind to an , proteins  |
| Molecular Weight: |
20, 3 kD |
| UniProt number: |
P42773 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CDKN2C (N-6His), Cyclin-Dependent Kinase 4 Inhibitor C |
| Short name: |
CDKN2C (N-6His), Recombinant Cyclin-Dependent Kinase 4 Inhibitor C |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
cyclin-dependent kinase inhibitor 2C (p18, inhibits cyclin-dependent kinase 4) (N-6His), sapiens Cyclin-Dependent phosphorylation catalyst 4 suppressor C, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CDKN2C and IDBG-639655 and ENSBTAG00000011059 and 505691, CDKN2C and IDBG-98423 and ENSG00000123080 and 1031, Cdkn2c and IDBG-174648 and ENSMUSG00000028551 and 12580, INK4C and p18 and p18-INK4C, inhibits CDK4), nuclei, protein kinase binding, this GO :0000079 and regulation of cyclin-dependent protein serine/threonine kinase activity and biological process this GO :0000082 and G1/S transition of mitotic cell cycle and biological process this GO :0000278 and mitotic cell cycle and biological process this GO :0004861 and cyclin-dependent protein serine/threonine kinase inhibitor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0007050 and cell cycle arrest and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0019901 and protein kinase binding and molecular function this GO :0030308 and negative regulation of cell growth and biological process this GO :0042326 and negative regulation of phosphorylation and biological process this GO :0048709 and oli this GO dendrocyte differentiation and biological process this GO :0071901 and negative regulation of protein serine/threonine kinase activity and biological process, this GO :0004861 : cyclin-dependent protein serine/threonine kinase inhibitor activity, this GO :0004861 : cyclin-dependent protein serine/threonine kinase inhibitor activity and also this GO :0005515 : protein binding and also this GO :0019901 : protein kinase binding, this GO :0005515 : protein binding, this GO :0019901 : protein kinase binding, cyclin-dependent kinase inhibitor 2C (p18 |
| Identity: |
1789 |
| Gene: |
CDKN2C |
More about : CDKN2C |
| Long gene name: |
cyclin dependent kinase inhibitor 2C |
| Synonyms gene name: |
cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) |
| Synonyms: |
INK4C p18 |
| Locus: |
1p32, 3 |
| Discovery year: |
1995-07-06 |
| GenBank acession: |
BC000598 |
| Entrez gene record: |
1031 |
| Pubmed identfication: |
8001816 9636670 |
| RefSeq identity: |
NM_001262 |
| Classification: |
Ankyrin repeat domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000008046 |