| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
T7 tag at the N-terminus, Recombinant Human Cyclin-Dependent Kinase 4 is produced by our E, coli expression system and the target gene encoding Met1-Glu303 is expressed with a 6His |
| Molecular Weight: |
2 kD, 37 |
| UniProt number: |
P11802 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CDK4 (N-6His), Cyclin-Dependent Kinase 4 |
| Short name: |
CDK4 (N-6His), Recombinant Cyclin-Dependent Kinase 4 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
cyclin-dependent kinase 4 (N-6His), sapiens Cyclin-Dependent phosphorylation catalyst 4, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CDK4 and IDBG-43642 and ENSG00000135446 and 1019, CMM3 and PSK-J3, Cdk4 and IDBG-194056 and ENSMUSG00000006728 and 102641469, nuclei, this GO :0000082 and G1/S transition of mitotic cell cycle and biological process this GO :0000278 and mitotic cell cycle and biological process this GO :0000307 and cyclin-dependent protein kinase holoenzyme complex and cellular component this GO :0000785 and chromatin and cellular component this GO :0002088 and lens development in camera-type eye and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004693 and cyclin-dependent protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005667 and transcription factor complex and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005829 and cytosol and cellular component this GO :0005923 and tight junction and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0007165 and signal transduction and biological process this GO :0007623 and circadian rhythm and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0009636 and response to toxic substance and biological process this GO :0010033 and response to organic substance and biological process this GO :0010288 and response to lead ion and biological process this GO :0010468 and regulation of gene expression and biological process this GO :0010971 and positive regulation of G2/M transition of mitotic cell cycle and biological process this GO :0016301 and kinase activity and molecular function this GO :0016772 and transferase activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004674 : protein serine/threonine kinase activity and also this GO :0004693 : cyclin-dependent protein serine/threonine kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016301 : kinase activity and also this GO :0016772 : transferase activity, this GO :0004674 : protein serine/threonine kinase activity, this GO :0004693 : cyclin-dependent protein serine/threonine kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0016301 : kinase activity, this GO :0016772 : transferase activity, this GO :0030332 : cyclin binding, this GO :0032403 : protein complex binding, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0030332 : cyclin binding and also this GO :0032403 : protein complex binding, transferring phosphorus-containing groups and molecular function this GO :0030332 and cyclin binding and molecular function this GO :0031100 and organ regeneration and biological process this GO :0031965 and nuclear membrane and cellular component this GO :0032403 and protein complex binding and molecular function this GO :0033574 and response to testosterone and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042493 and response to drug and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0045727 and positive regulation of translation and biological process this GO :0045793 and positive regulation of cell size and biological process this GO :0048146 and positive regulation of fibroblast proliferation and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0051301 and cell division and biological process this GO :0051726 and regulation of cell cycle and biological process this GO :0055093 and response to hyperoxia and biological process this GO :0071157 and negative regulation of cell cycle arrest and biological process, 12567, cyclin-dependent kinase 4 |
| Identity: |
1773 |
| Gene: |
CDK4 |
More about : CDK4 |
| Long gene name: |
cyclin dependent kinase 4 |
| Synonyms: |
PSK-J3 |
| Locus: |
12q14, 1 |
| Discovery year: |
1993-07-28 |
| GenBank acession: |
M14505 |
| Entrez gene record: |
1019 |
| Pubmed identfication: |
8275715 |
| RefSeq identity: |
NM_000075 |
| Classification: |
Cyclin dependent kinases |
| Havana BLAST/BLAT: |
OTTHUMG00000170382 |
| Locus Specific Databases: |
LRG_490 |