Recombinant Human Cyclin-Dependent Kinase 4 Inhibitor C, CDKN2C (N-6His)

Contact us
Catalog number: C243
Price: 322 €
Supplier: ABM lentivectors
Product name: Recombinant Human Cyclin-Dependent Kinase 4 Inhibitor C, CDKN2C (N-6His)
Quantity: 1.0 µg DNA
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Not all receptor antagonist that bind to enzymes are inhibitors, Since blocking an enzyme's activity can kill a pathogen , activator, caspase, esterase inhibitors , lipoprotein, many drugs are enzyme inhibitors, papain, pathway, peptidase, protease , proteinase, trypsin, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme,  , Tissue, acrosin, activity, and decreases its , are , bind to enzymes and increase their , enzymatic activity, enzyme activator ligands or agonists , enzyme receptor , imbalance, metabolic , or correct a , or receptor ligands or receptor antagonists that bind to an , proteins 
Molecular Weight: 20, 3 kD
UniProt number: P42773
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CDKN2C (N-6His), Cyclin-Dependent Kinase 4 Inhibitor C
Short name: CDKN2C (N-6His), Recombinant Cyclin-Dependent Kinase 4 Inhibitor C
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: cyclin-dependent kinase inhibitor 2C (p18, inhibits cyclin-dependent kinase 4) (N-6His), sapiens Cyclin-Dependent phosphorylation catalyst 4 suppressor C, recombinant H
Alternative technique: rec
Alternative to gene target: CDKN2C and IDBG-639655 and ENSBTAG00000011059 and 505691, CDKN2C and IDBG-98423 and ENSG00000123080 and 1031, Cdkn2c and IDBG-174648 and ENSMUSG00000028551 and 12580, INK4C and p18 and p18-INK4C, inhibits CDK4), nuclei, protein kinase binding, this GO :0000079 and regulation of cyclin-dependent protein serine/threonine kinase activity and biological process this GO :0000082 and G1/S transition of mitotic cell cycle and biological process this GO :0000278 and mitotic cell cycle and biological process this GO :0004861 and cyclin-dependent protein serine/threonine kinase inhibitor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0007050 and cell cycle arrest and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0019901 and protein kinase binding and molecular function this GO :0030308 and negative regulation of cell growth and biological process this GO :0042326 and negative regulation of phosphorylation and biological process this GO :0048709 and oli this GO dendrocyte differentiation and biological process this GO :0071901 and negative regulation of protein serine/threonine kinase activity and biological process, this GO :0004861 : cyclin-dependent protein serine/threonine kinase inhibitor activity, this GO :0004861 : cyclin-dependent protein serine/threonine kinase inhibitor activity and also this GO :0005515 : protein binding and also this GO :0019901 : protein kinase binding, this GO :0005515 : protein binding, this GO :0019901 : protein kinase binding, cyclin-dependent kinase inhibitor 2C (p18
Identity: 1789
Gene: CDKN2C | More about : CDKN2C
Long gene name: cyclin dependent kinase inhibitor 2C
Synonyms gene name: cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
Synonyms: INK4C p18
Locus: 1p32, 3
Discovery year: 1995-07-06
GenBank acession: BC000598
Entrez gene record: 1031
Pubmed identfication: 8001816 9636670
RefSeq identity: NM_001262
Classification: Ankyrin repeat domain containing
Havana BLAST/BLAT: OTTHUMG00000008046

Related Products :

C243 Recombinant Human Cyclin-Dependent Kinase 4 Inhibitor C, CDKN2C (N-6His) 10 µg 202 € novo human
YSGKAMCC107E Cyclin Dependent Kinase 2 (cdk2), Cyclin Dependent Kinase 5 (cdk5), NO X w/Cyclin Dependent Kinase (cdk)1, ~33kD, Clone: 8A12, Mouse Monoclonal antibody-Human, Mouse; WB 0.1mg 1271 € accurate-monoclonals mouse
GWB-B148BA Cyclin-dependent Kinase Inhibitor 2C (p18, Inhibits CDK4) (CDKN2C) Rabbit antibody to or anti-Mouse Polyclonal (C- terminus) antibody 1 vial 648 € genways mouse
MBS616679 CDKN1B (CDKN1B, cyclin-dependent kinase inhibitor 1B (p27, Kip1), KIP1, CDKN4, P27KIP1, cyclin-dependent kinase inhibitor 1B, p27(KIP1), KIP1, p27) 100ug 735 € MBS Polyclonals_1 human
MBS624101 p27Kip1, phosphorylated (Thr198) (Cyclin-dependent Kinase Inhibitor 1B, Cyclin-dependent Kinase Inhibitor p27, CDKN1B, KIP1) 200ul 603 € MBS Polyclonals_1 human
CE72 Recombinant Human Cyclin-Dependent Kinase Inhibitor 1, CDKN1A, p21 (C-6His) 1 mg 2283 € novo human
C288 Recombinant Human Cyclin-Dependent Kinase Inhibitor 1B, CDKN1B (N-6His) 50 µg 496 € novo human
C977 Recombinant Human Cyclin-Dependent Kinase 2-Associated Protein 1, CDK2AP1 (C-6His) 10 µg 202 € novo human
C211 Recombinant Human Cyclin-Dependent Kinase 2, CDK2 (N-6His) 500 µg 1613 € novo human
CF12 Recombinant Human Cyclin-Dependent Kinase 4, CDK4 (N-6His) 50 µg 369 € novo human
CF11 Recombinant Human Cyclin-Dependent Kinase 6, CDK6 (N-6His) 1 mg 2283 € novo human
C842 Recombinant Human Cyclin-Dependent Kinase 7, CDK7 (N-6His) 50 µg 496 € novo human
MBS614982 Kip1 p57 (cdk Inhibitor, Cyclin Dependent Kinase Inhibitor) Antibody 200ug 625 € MBS Polyclonals_1 human
MBS615181 Kip2, p57 (cdk Inhibitor, Cyclin Dependent Kinase Inhibitor) Antibody 200ug 625 € MBS Polyclonals_1 human
MBS618568 Kip2, p57 (cdk Inhibitor, Cyclin Dependent Kinase Inhibitor) Antibody 0.25 ml 453 € MBS Polyclonals_1 human
C247 Recombinant Human cAMP-dependent Protein Kinase Inhibitor β, PKI-β (N-6His) 50 µg 496 € novo human
RP-746 Recombinant (E.Coli) Human Cyclin-Dependent Kinase Inhibitor 2A 10 μg 260 € adi human
YSGKAMCC200E Cyclin D1, Cyclin D2, NO X w/Cyclin D3, ~36&34kD, Clone: 5D4, Mouse Monoclonal antibody-Human, Mouse; WB/ICC/IHC 0.1mg 1097 € accurate-monoclonals mouse
GWB-P0661K CDKN2C, 1-168aa, Recombinant Protein bulk Ask price € genways bulk human
abx167706 Anti-Cyclin Dependent Kinase Inhibitor 1A Protein (Recombinant) 50 μg 630 € abbex human
abx167785 Anti-Cyclin Dependent Kinase Inhibitor 2A Protein (Recombinant) 100 μg 934 € abbex human
abx166717 Anti-Cyclin Dependent Kinase Inhibitor 3 Protein (Recombinant) 50 μg 601 € abbex human
BMDV10102 p16INK4a (Cyclin Dependent Kinase Inhibitor), Tumor Suppressor Protein, 16kD, Clone: ZJ11, Mouse Monoclonal antibody-Human, NO X w/Mouse or Rat; IF/Kinase/WB/IP (native & denatured) 500ul 808 € accurate-monoclonals rat
MBS622298 Hematopoietic Progenitor Kinase 1 (HPK1, Mitogen-activated Protein Kinase Kinase Kinase Kinase 1, MAP4K1, MAPK/ERK Kinase Kinase Kinase 1, MEK Kinase Kinase 1, MEKKK 1) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS624216 MAP4K1, phosphorylated (Ser171) (Mitogen-activated Protein Kinase Kinase Kinase Kinase 1, MAPK/ERK Kinase Kinase Kinase 1, MEK Kinase Kinase 1, MEKKK 1, Hematopoietic Progenitor Kinase, HPK1) Antibody 200ul 603 € MBS Polyclonals_1 human
LV115063 CDKN2C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV115064 CDKN2C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV115065 CDKN2C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV115066 CDKN2C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV115068 CDKN2C Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human