Recombinant Human Parvalbumin α, PVALB (C-6His)

Catalog number:	C157 Buy Now
Price:	265 €
Supplier:	MBS Polyclonals
Product name:	Recombinant Human Parvalbumin α, PVALB (C-6His)
Quantity:	0.06 ml
Other quantities:	1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:	human pvalb sapiens chis homo

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Parvalbumin alpha is produced by our E, coli expression system and the target gene encoding Ser2-Ser110 is expressed with a 6His tag at the C-terminus
Molecular Weight:	12 kD, 13
UniProt number:	P20472
State of the product:	Freeze-dried
Shipping conditions:	Ambient temperature
Formulation:	150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations:	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution:	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAESLEHHHHHH
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	PVALB (C-6His), Parvalbumin &alpha
Short name:	PVALB (C-6His), Recombinant Parvalbumin &alpha
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans
Alternative name:	PVALB (C-6His), sapiens Parvalbumin &alpha, recombinant H
Alternative technique:	rec
Identity:	9704
Gene:	PVALB | More about : PVALB
Long gene name:	parvalbumin
Synonyms:	D22S749
Locus:	22q12, 3
Discovery year:	1986-01-01
Entrez gene record:	5816
Pubmed identfication:	1559707 10591208
RefSeq identity:	NM_002854
Classification:	EF-hand domain containing
Havana BLAST/BLAT:	OTTHUMG00000150547

• #human
• #pvalb
• #sapiens
• #chis
• #homo