Recombinant Human Parvalbumin α, PVALB (C-6His)

Contact us
Catalog number: C157
Price: 265 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Parvalbumin α, PVALB (C-6His)
Quantity: 0.06 ml
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Parvalbumin alpha is produced by our E, coli expression system and the target gene encoding Ser2-Ser110 is expressed with a 6His tag at the C-terminus
Molecular Weight: 12 kD, 13
UniProt number: P20472
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAESLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PVALB (C-6His), Parvalbumin &alpha
Short name: PVALB (C-6His), Recombinant Parvalbumin &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: PVALB (C-6His), sapiens Parvalbumin &alpha, recombinant H
Alternative technique: rec
Identity: 9704
Gene: PVALB | More about : PVALB
Long gene name: parvalbumin
Synonyms: D22S749
Locus: 22q12, 3
Discovery year: 1986-01-01
Entrez gene record: 5816
Pubmed identfication: 1559707 10591208
RefSeq identity: NM_002854
Classification: EF-hand domain containing
Havana BLAST/BLAT: OTTHUMG00000150547

Related Products :

C157 Recombinant Human Parvalbumin α, PVALB (C-6His) 500 µg 1613 € novo human
AR09718PU-L anti-Parvalbumin alpha / PVALB (1-110, His-tag) Antibody 0,5 mg 1138 € acr human
AR09718PU-N anti-Parvalbumin alpha / PVALB (1-110, His-tag) Antibody 0,1 mg 485 € acr human
CPA1978-100ul anti-Parvalbumin alpha / PVALB Antibody 0,1 ml 442 € acr human
CPA1978-200ul anti-Parvalbumin alpha / PVALB Antibody 0,2 ml 688 € acr human
CPA1978-30ul anti-Parvalbumin alpha / PVALB Antibody 30 Вµl 326 € acr human
MO22149-100 anti-Parvalbumin alpha / PVALB Antibody 0,1 ml 601 € acr human
AE24974RB-48 ELISA test for Rabbit Parvalbumin alpha (PVALB) 1x plate of 48 wells 402 € abebio human
GENTAUR-58bb6612e1600 Gerbillus sp. Parvalbumin alpha (PVALB) 100ug 1393 € MBS Recombinant Proteins human
GENTAUR-58bb66133cbb4 Gerbillus sp. Parvalbumin alpha (PVALB) 1000ug 1393 € MBS Recombinant Proteins human
GENTAUR-58bb66138a107 Gerbillus sp. Parvalbumin alpha (PVALB) 100ug 1895 € MBS Recombinant Proteins human
GENTAUR-58bb6613c1fff Gerbillus sp. Parvalbumin alpha (PVALB) 1000ug 1895 € MBS Recombinant Proteins human
GENTAUR-58b87a2bd5a3a Macaca fuscata fuscata Parvalbumin alpha (PVALB) 100ug 1393 € MBS Recombinant Proteins human
GENTAUR-58b87a2c2ce16 Macaca fuscata fuscata Parvalbumin alpha (PVALB) 1000ug 1393 € MBS Recombinant Proteins human
GENTAUR-58b87a2c79413 Macaca fuscata fuscata Parvalbumin alpha (PVALB) 100ug 1895 € MBS Recombinant Proteins human
GENTAUR-58b87a2cb0ff2 Macaca fuscata fuscata Parvalbumin alpha (PVALB) 1000ug 1895 € MBS Recombinant Proteins human
AE24974RB Rabbit Parvalbumin alpha (PVALB) ELISA Kit 48 wells plate 525 € ab-elisa elisas human
AE24974RB-96 Rabbit Parvalbumin alpha (PVALB) ELISA Kit 1x plate of 96 wells 671 € abebio human
abx573976 Anti-Human Parvalbumin (PVALB) ELISA Kit 96 tests 789 € abbex human
MBS242380 Goat Polyclonal to Human PVALB / Parvalbumin Antibody 50ug 597 € MBS Polyclonals_1 human
DL-PVALB-Hu Human Parvalbumin PVALB ELISA Kit 96T 904 € DL elisas human
abx573552 Anti-Rat Parvalbumin (PVALB) ELISA Kit inquire 50 € abbex rat
EKU06494 Parvalbumin (PVALB) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU06495 Parvalbumin (PVALB) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human
DL-PVALB-Ra Rat Parvalbumin PVALB ELISA Kit 96T 962 € DL elisas rat
GWB-P1259K PVALB, 1-110aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-BSP566 PVALB Human Protein bulk Ask price € genways bulk human
GENTAUR-58bdee19c1f8f Anti- PVALB Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdee1a11e75 Anti- PVALB Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfd9b08923 Anti- PVALB Antibody 0.06 ml 265 € MBS Polyclonals human