| Catalog number: | C157 |
|---|---|
| Price: | 265 € |
| Supplier: | MBS Polyclonals |
| Product name: | Recombinant Human Parvalbumin α, PVALB (C-6His) |
| Quantity: | 0.06 ml |
| Other quantities: | 10 µg 156€ 50 µg 369€ 500 µg 1613€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Parvalbumin alpha is produced by our E, coli expression system and the target gene encoding Ser2-Ser110 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: | 12 kD, 13 |
| UniProt number: | P20472 |
| State of the product: | Freeze-dried |
| Shipping conditions: | Ambient temperature |
| Formulation: | 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAESLEHHHHHH |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | PVALB (C-6His), Parvalbumin &alpha |
| Short name: | PVALB (C-6His), Recombinant Parvalbumin &alpha |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans |
| Alternative name: | PVALB (C-6His), sapiens Parvalbumin &alpha, recombinant H |
| Alternative technique: | rec |
| Identity: | 9704 |
| Gene: | PVALB | More about : PVALB |
| Long gene name: | parvalbumin |
| Synonyms: | D22S749 |
| Locus: | 22q12, 3 |
| Discovery year: | 1986-01-01 |
| Entrez gene record: | 5816 |
| Pubmed identfication: | 1559707 10591208 |
| RefSeq identity: | NM_002854 |
| Classification: | EF-hand domain containing |
| Havana BLAST/BLAT: | OTTHUMG00000150547 |
| C157 | Recombinant Human Parvalbumin α, PVALB (C-6His) | 500 µg | 1613 € | novo | human |
| AR09718PU-L | anti-Parvalbumin alpha / PVALB (1-110, His-tag) Antibody | 0,5 mg | 1138 € | acr | human |
| AR09718PU-N | anti-Parvalbumin alpha / PVALB (1-110, His-tag) Antibody | 0,1 mg | 485 € | acr | human |
| CPA1978-100ul | anti-Parvalbumin alpha / PVALB Antibody | 0,1 ml | 442 € | acr | human |
| CPA1978-200ul | anti-Parvalbumin alpha / PVALB Antibody | 0,2 ml | 688 € | acr | human |
| CPA1978-30ul | anti-Parvalbumin alpha / PVALB Antibody | 30 Вµl | 326 € | acr | human |
| MO22149-100 | anti-Parvalbumin alpha / PVALB Antibody | 0,1 ml | 601 € | acr | human |
| AE24974RB-48 | ELISA test for Rabbit Parvalbumin alpha (PVALB) | 1x plate of 48 wells | 402 € | abebio | human |
| GENTAUR-58bb6612e1600 | Gerbillus sp. Parvalbumin alpha (PVALB) | 100ug | 1393 € | MBS Recombinant Proteins | human |
| GENTAUR-58bb66133cbb4 | Gerbillus sp. Parvalbumin alpha (PVALB) | 1000ug | 1393 € | MBS Recombinant Proteins | human |
| GENTAUR-58bb66138a107 | Gerbillus sp. Parvalbumin alpha (PVALB) | 100ug | 1895 € | MBS Recombinant Proteins | human |
| GENTAUR-58bb6613c1fff | Gerbillus sp. Parvalbumin alpha (PVALB) | 1000ug | 1895 € | MBS Recombinant Proteins | human |
| GENTAUR-58b87a2bd5a3a | Macaca fuscata fuscata Parvalbumin alpha (PVALB) | 100ug | 1393 € | MBS Recombinant Proteins | human |
| GENTAUR-58b87a2c2ce16 | Macaca fuscata fuscata Parvalbumin alpha (PVALB) | 1000ug | 1393 € | MBS Recombinant Proteins | human |
| GENTAUR-58b87a2c79413 | Macaca fuscata fuscata Parvalbumin alpha (PVALB) | 100ug | 1895 € | MBS Recombinant Proteins | human |
| GENTAUR-58b87a2cb0ff2 | Macaca fuscata fuscata Parvalbumin alpha (PVALB) | 1000ug | 1895 € | MBS Recombinant Proteins | human |
| AE24974RB | Rabbit Parvalbumin alpha (PVALB) ELISA Kit | 48 wells plate | 525 € | ab-elisa elisas | human |
| AE24974RB-96 | Rabbit Parvalbumin alpha (PVALB) ELISA Kit | 1x plate of 96 wells | 671 € | abebio | human |
| abx573976 | Anti-Human Parvalbumin (PVALB) ELISA Kit | 96 tests | 789 € | abbex | human |
| MBS242380 | Goat Polyclonal to Human PVALB / Parvalbumin Antibody | 50ug | 597 € | MBS Polyclonals_1 | human |
| DL-PVALB-Hu | Human Parvalbumin PVALB ELISA Kit | 96T | 904 € | DL elisas | human |
| abx573552 | Anti-Rat Parvalbumin (PVALB) ELISA Kit | inquire | 50 € | abbex | rat |
| EKU06494 | Parvalbumin (PVALB) ELISA kit | 1 plate of 96 wells | 822 € | Biomatik ELISA kits | human |
| EKU06495 | Parvalbumin (PVALB) ELISA kit | 1 plate of 96 wells | 888 € | Biomatik ELISA kits | human |
| DL-PVALB-Ra | Rat Parvalbumin PVALB ELISA Kit | 96T | 962 € | DL elisas | rat |
| GWB-P1259K | PVALB, 1-110aa, Recombinant Protein | bulk | Ask price € | genways bulk | human |
| GWB-BSP566 | PVALB Human Protein | bulk | Ask price € | genways bulk | human |
| GENTAUR-58bdee19c1f8f | Anti- PVALB Antibody | 0.06 ml | 265 € | MBS Polyclonals | human |
| GENTAUR-58bdee1a11e75 | Anti- PVALB Antibody | 0.12 ml | 348 € | MBS Polyclonals | human |
| GENTAUR-58bdfd9b08923 | Anti- PVALB Antibody | 0.06 ml | 265 € | MBS Polyclonals | human |