| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
44 kD, 8 |
| UniProt number: |
O14625 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2, 500 mM sodium chloride, pH 9, 2 um filtered solution of 20 mM TrisHCl, 5 mM EDTA, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CXCL11, C-X-C Motif Chemokine 11 |
| Short name: |
CXCL11, Recombinant C-X-C Motif Chemokine 11 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
chemokine (C-X-C motif) ligand 11, sapiens C-X-C Motif Chemokine 11, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CXCL11 and IDBG-25238 and ENSG00000169248 and 6373, CXCL11 and IDBG-643112 and ENSBTAG00000005603 and 516104, CXCR3 chemokine receptor binding, Cxcl11 and IDBG-179944 and ENSMUSG00000060183 and 56066, Extracellular, b-R1 and H174 and I-TAC and IP-9 and IP9 and SCYB11 and SCYB9B, this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0010818 and T cell chemotaxis and biological process this GO :0030816 and positive regulation of cAMP metabolic process and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0043950 and positive regulation of cAMP-mediated signaling and biological process this GO :0045087 and innate immune response and biological process this GO :0048248 and CXCR3 chemokine receptor binding and molecular function this GO :0051281 and positive regulation of release of sequestered calcium ion into cytosol and biological process this GO :0070098 and chemokine-mediated signaling pathway and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008009 : chemokine activity and also this GO :0008201 : heparin binding and also this GO :0048248 : CXCR3 chemokine receptor binding, this GO :0008009 : chemokine activity, this GO :0008201 : heparin binding, this GO :0048248 : CXCR3 chemokine receptor binding, chemokine (C-X-C motif) ligand 11 |
| Identity: |
10638 |
| Gene: |
CXCL11 |
More about : CXCL11 |
| Long gene name: |
C-X-C motif chemokine ligand 11 |
| Synonyms gene: |
SCYB9B SCYB11 |
| Synonyms gene name: |
member 11 chemokine (C-X-C motif) ligand 11 , small inducible cytokine subfamily B (Cys-X-Cys) |
| Synonyms: |
H174 b-R1 I-TAC IP-9 |
| Locus: |
4q21, 1 |
| Discovery year: |
1998-06-23 |
| GenBank acession: |
U66096 |
| Entrez gene record: |
6373 |
| Pubmed identfication: |
9730616 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000130101 |