Recombinant Human C-X-C Motif Chemokine 11, CXCL11

Contact us
Catalog number: C119
Price: 707 €
Supplier: MBS mono
Product name: Recombinant Human C-X-C Motif Chemokine 11, CXCL11
Quantity: 100ul
Other quantities: 10 µg 168€ 50 µg 405€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines
Molecular Weight: 44 kD, 8
UniProt number: O14625
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2, 500 mM sodium chloride, pH 9, 2 um filtered solution of 20 mM TrisHCl, 5 mM EDTA, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CXCL11, C-X-C Motif Chemokine 11
Short name: CXCL11, Recombinant C-X-C Motif Chemokine 11
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: chemokine (C-X-C motif) ligand 11, sapiens C-X-C Motif Chemokine 11, recombinant H
Alternative technique: rec
Alternative to gene target: CXCL11 and IDBG-25238 and ENSG00000169248 and 6373, CXCL11 and IDBG-643112 and ENSBTAG00000005603 and 516104, CXCR3 chemokine receptor binding, Cxcl11 and IDBG-179944 and ENSMUSG00000060183 and 56066, Extracellular, b-R1 and H174 and I-TAC and IP-9 and IP9 and SCYB11 and SCYB9B, this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0010818 and T cell chemotaxis and biological process this GO :0030816 and positive regulation of cAMP metabolic process and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0043950 and positive regulation of cAMP-mediated signaling and biological process this GO :0045087 and innate immune response and biological process this GO :0048248 and CXCR3 chemokine receptor binding and molecular function this GO :0051281 and positive regulation of release of sequestered calcium ion into cytosol and biological process this GO :0070098 and chemokine-mediated signaling pathway and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008009 : chemokine activity and also this GO :0008201 : heparin binding and also this GO :0048248 : CXCR3 chemokine receptor binding, this GO :0008009 : chemokine activity, this GO :0008201 : heparin binding, this GO :0048248 : CXCR3 chemokine receptor binding, chemokine (C-X-C motif) ligand 11
Identity: 10638
Gene: CXCL11 | More about : CXCL11
Long gene name: C-X-C motif chemokine ligand 11
Synonyms gene: SCYB9B SCYB11
Synonyms gene name: member 11 chemokine (C-X-C motif) ligand 11 , small inducible cytokine subfamily B (Cys-X-Cys)
Synonyms: H174 b-R1 I-TAC IP-9
Locus: 4q21, 1
Discovery year: 1998-06-23
GenBank acession: U66096
Entrez gene record: 6373
Pubmed identfication: 9730616
Classification: Endogenous ligands Chemokine ligands
Havana BLAST/BLAT: OTTHUMG00000130101

Related Products :

MBS621737 CCL14, aa1-16 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621594 CCL14, aa21-35 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621551 CCL14, aa44-55 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621623 CCL14, aa62-74 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 20ul 509 € MBS Polyclonals_1 human
MBS622517 CCL14, aa8-15 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
C119 Recombinant Human C-X-C Motif Chemokine 11, CXCL11 50 µg 405 € novo human
MBS624336 CX3CR1, EL (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624136 CX3CR1, NT (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624063 Macrophage, Monocyte Chemotactic Protein-1 (CCL2, Chemokine (C-C motif) ligand 2, C-C motif chemokine 2, GDCF-2, HC11, HSMCR30, MCAF, MCP1, MCP-1, MGC9434, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotacti Antibody 100ug 763 € MBS Polyclonals_1 human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human
MBS619508 TRIM4 (Tripartite Motif Containing 4, Tripartite Motif-containing 4, Tripartite Motif Protein 4, Tripartite Motif Protein TRIM4, Ring Finger Protein 87, RNF87) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620811 TRIM5 (Tripartite Motif Containing 5, Tripartite Motif-containing 5, Tripartite Motif Protein 5, Tripartite Motif Protein TRIM5, RING Finger Protein 88, RNF88) Antibody 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58b87ba33a229 Human C-X-C motif chemokine 11 (CXCL11) 100ug 1299 € MBS Recombinant Proteins human
GENTAUR-58b87ba3919d6 Human C-X-C motif chemokine 11 (CXCL11) 1000ug 1299 € MBS Recombinant Proteins human
GENTAUR-58b87ba40c885 Human C-X-C motif chemokine 11 (CXCL11) 100ug 1801 € MBS Recombinant Proteins human
GENTAUR-58b87ba475820 Human C-X-C motif chemokine 11 (CXCL11) 1000ug 1801 € MBS Recombinant Proteins human
GENTAUR-58b8db2e87a7f Bovine C-X-C motif chemokine 11 (CXCL11) 100ug 1315 € MBS Recombinant Proteins bovine
GENTAUR-58b8db2f05749 Bovine C-X-C motif chemokine 11 (CXCL11) 1000ug 1315 € MBS Recombinant Proteins bovine
GENTAUR-58b8db2f6440e Bovine C-X-C motif chemokine 11 (CXCL11) 100ug 1818 € MBS Recombinant Proteins bovine
GENTAUR-58b8db2fcfadf Bovine C-X-C motif chemokine 11 (CXCL11) 1000ug 1818 € MBS Recombinant Proteins bovine
GENTAUR-58b9d733ab2e8 Bovine C-X-C motif chemokine 11 (CXCL11) 100ug 1315 € MBS Recombinant Proteins bovine
GENTAUR-58b9d7346fdcb Bovine C-X-C motif chemokine 11 (CXCL11) 1000ug 1315 € MBS Recombinant Proteins bovine
GENTAUR-58b9d734c7b0e Bovine C-X-C motif chemokine 11 (CXCL11) 100ug 1818 € MBS Recombinant Proteins bovine
GENTAUR-58b9d73540f8d Bovine C-X-C motif chemokine 11 (CXCL11) 1000ug 1818 € MBS Recombinant Proteins bovine
MBS616766 CXCL11 (Chemokine (C-X-C Motif) Ligand 11, b R1, H174, Interferon-inducible T Cell Alpha Chemoattractant, I-TAC, Interferon gamma Inducible Protein 9, IP-9, MGC102770, Small Inducible Cytokine B11, SCYB11, SCYB9B) Antibody 50ug 625 € MBS Polyclonals_1 human
GENTAUR-58bd8966d0fb3 Mouse C-X-C motif chemokine 11 (Cxcl11) 100ug 1315 € MBS Recombinant Proteins mouse
GENTAUR-58bd89675a95b Mouse C-X-C motif chemokine 11 (Cxcl11) 1000ug 1315 € MBS Recombinant Proteins mouse
GENTAUR-58bd8967c19fa Mouse C-X-C motif chemokine 11 (Cxcl11) 100ug 1818 € MBS Recombinant Proteins mouse
GENTAUR-58bd89682ef24 Mouse C-X-C motif chemokine 11 (Cxcl11) 1000ug 1818 € MBS Recombinant Proteins mouse
GENTAUR-58be31bbb4dcf CCR8, loop2 (chemokine receptor 8, C-C chemokine receptor type 8, CC-CKR-8, C-C CKR-8, CCR-8, CDw198, Chemokine receptor-like 1, CKRL1) Antibody 100ul 707 € MBS mono human