| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human B Cell Lymphoma is produced by our E, coli expression system and the target gene encoding Ala2-Thr172 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
19, 87 kD |
| UniProt number: |
Q92843 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
100 mM KCl, 20% Glycerol, pH 7, 2 um filtered solution of 25 mM HEPES, 5, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
BCL2L2 (C-6His), Bcl-2-Llike Protein 2 |
| Short name: |
BCL2L2 (C-6His), Recombinant Bcl-2-Llike Protein 2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
B-cell CLL/lymphoma 2-like 2 (C-6His), sapiens Bcl-2-Llike Protein 2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BCL-W and BCL2-L-2 and BCLW and PPP1R51, BCL2L2 and IDBG-3157 and ENSG00000129473 and 599, BCL2L2 and IDBG-645824 and ENSBTAG00000019692 and 767601, BH domain binding, Bcl2l2 and IDBG-486097 and ENSMUSG00000089682 and 12050, Cytoplasm, this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005741 and mitochondrial outer membrane and cellular component this GO :0005829 and cytosol and cellular component this GO :0006915 and apoptotic process and biological process this GO :0007283 and spermatogenesis and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0031966 and mitochondrial membrane and cellular component this GO :0042803 and protein homodimerization activity and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0051400 and BH domain binding and molecular function this GO :0060011 and Sertoli cell proliferation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0097192 and extrinsic apoptotic signaling pathway in absence of ligand and biological process this GO :2001243 and negative regulation of intrinsic apoptotic signaling pathway and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046982 : protein heterodimerization activity and also this GO :0051400 : BH domain binding, this GO :0042803 : protein homodimerization activity, this GO :0046982 : protein heterodimerization activity, this GO :0051400 : BH domain binding, BCL2-like 2 |
| Identity: |
995 |
| Gene: |
BCL2L2 |
More about : BCL2L2 |
| Long gene name: |
BCL2 like 2 |
| Synonyms: |
KIAA0271 BCL-W PPP1R51 |
| Synonyms name: |
protein phosphatase 1, regulatory subunit 51 |
| Locus: |
14q11, 2 |
| Discovery year: |
1997-07-22 |
| GenBank acession: |
D87461 |
| Entrez gene record: |
599 |
| Pubmed identfication: |
8761287 |
| RefSeq identity: |
NM_004050 |
| Classification: |
Protein phosphatase 1 regulatory subunits BCL2 family |
| Havana BLAST/BLAT: |
OTTHUMG00000028738 |