| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
4 kD, 9 |
| UniProt number: |
O95715 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
1M sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, 5, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CXCL14, C-X-C Motif Chemokine 14 |
| Short name: |
CXCL14, Recombinant C-X-C Motif Chemokine 14 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
chemokine (C-X-C motif) ligand 14, sapiens C-X-C Motif Chemokine 14, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BMAC and BRAK and KEC and KS1 and MIP-2g and MIP2G and NJAC and SCYB14, CXCL14 and IDBG-45673 and ENSG00000145824 and 9547, CXCL14 and IDBG-645845 and ENSBTAG00000006694 and 511771, Cxcl14 and IDBG-157150 and ENSMUSG00000021508 and 57266, Extracellular, chemokine activity, this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0045087 and innate immune response and biological process this GO :0048839 and inner ear development and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0008009 : chemokine activity, this GO :0008009 : chemokine activity, chemokine (C-X-C motif) ligand 14 |
| Identity: |
10640 |
| Gene: |
CXCL14 |
More about : CXCL14 |
| Long gene name: |
C-X-C motif chemokine ligand 14 |
| Synonyms gene: |
SCYB14 |
| Synonyms gene name: |
member 14 (BRAK) chemokine (C-X-C motif) ligand 14 , small inducible cytokine subfamily B (Cys-X-Cys) |
| Synonyms: |
BRAK NJAC bolekine Kec MIP-2g BMAC KS1 |
| Synonyms name: |
breast and kidney |
| Locus: |
5q31, 1 |
| Discovery year: |
1999-07-30 |
| GenBank acession: |
AF073957 |
| Entrez gene record: |
9547 |
| Pubmed identfication: |
10049774 |
| RefSeq identity: |
NM_004887 |
| Classification: |
Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000129139 |