Recombinant Human C-X-C Motif Chemokine 4, CXCL4, PF4

Contact us
Catalog number: C055
Price: 256 €
Supplier: Zyagen
Product name: Recombinant Human C-X-C Motif Chemokine 4, CXCL4, PF4
Quantity: 0.005 mg
Other quantities: 10 µg 168€ 50 µg 405€ 500 µg 1298€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines
Molecular Weight: 7, 8 kD
UniProt number: P02776
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 8, 2 um filtered solution of 50 mM TrisHCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CXCL4, PF4, C-X-C Motif Chemokine 4
Short name: CXCL4, PF4, Recombinant C-X-C Motif Chemokine 4
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CXCL4, platelet factor 4, sapiens C-X-C Motif Chemokine 4, recombinant H
Alternative technique: rec
Alternative to gene target: CXCL4 and PF-4 and SCYB4, CXCR3 chemokine receptor binding, Extracellular, PF4 and IDBG-24097 and ENSG00000163737 and 5196, this GO :0002576 and platelet degranulation and biological process this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006955 and immune response and biological process this GO :0007596 and blood coagulation and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0010628 and positive regulation of gene expression and biological process this GO :0010744 and positive regulation of macrophage derived foam cell differentiation and biological process this GO :0016525 and negative regulation of angiogenesis and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030168 and platelet activation and biological process this GO :0030595 and leukocyte chemotaxis and biological process this GO :0030816 and positive regulation of cAMP metabolic process and biological process this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0032760 and positive regulation of tumor necrosis factor production and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0043950 and positive regulation of cAMP-mediated signaling and biological process this GO :0045347 and negative regulation of MHC class II biosynthetic process and biological process this GO :0045651 and positive regulation of macrophage differentiation and biological process this GO :0045653 and negative regulation of megakaryocyte differentiation and biological process this GO :0045918 and negative regulation of cytolysis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048248 and CXCR3 chemokine receptor binding and molecular function this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0008009 : chemokine activity, this GO :0008009 : chemokine activity and also this GO :0008201 : heparin binding and also this GO :0048248 : CXCR3 chemokine receptor binding, this GO :0008201 : heparin binding, this GO :0048248 : CXCR3 chemokine receptor binding, platelet factor 4
Identity: 8861
Gene: PF4 | More about : PF4
Long gene name: platelet factor 4
Synonyms gene name: platelet factor 4
Synonyms: SCYB4 CXCL4
Synonyms name: chemokine (C-X-C motif) ligand 4
Locus: 4q13, 3
Discovery year: 2001-06-22
GenBank acession: M25897
Entrez gene record: 5196
Pubmed identfication: 3622011
Havana BLAST/BLAT: OTTHUMG00000130009

Related Products :

C055 Recombinant Human C-X-C Motif Chemokine 4, CXCL4, PF4 500 µg 1298 € novo human
CJ27 Recombinant Human C-X-C Motif Chemokine 4, CXCL4, PF4 (C-6His) 10 µg 156 € novo human
MBS621737 CCL14, aa1-16 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621594 CCL14, aa21-35 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621551 CCL14, aa44-55 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621623 CCL14, aa62-74 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 20ul 509 € MBS Polyclonals_1 human
MBS622517 CCL14, aa8-15 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS242471 Sheep Polyclonal (IgG) to Human CXCL4 / PF4 Antibody 50ug 597 € MBS Polyclonals_1 human
BB-EK0727 anti-Mouse CXCL4/PF4 ELISA Kit Antibody 96 Tests 659 € acr mouse
MBS624336 CX3CR1, EL (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624136 CX3CR1, NT (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624063 Macrophage, Monocyte Chemotactic Protein-1 (CCL2, Chemokine (C-C motif) ligand 2, C-C motif chemokine 2, GDCF-2, HC11, HSMCR30, MCAF, MCP1, MCP-1, MGC9434, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotacti Antibody 100ug 763 € MBS Polyclonals_1 human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human
MBS619508 TRIM4 (Tripartite Motif Containing 4, Tripartite Motif-containing 4, Tripartite Motif Protein 4, Tripartite Motif Protein TRIM4, Ring Finger Protein 87, RNF87) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620811 TRIM5 (Tripartite Motif Containing 5, Tripartite Motif-containing 5, Tripartite Motif Protein 5, Tripartite Motif Protein TRIM5, RING Finger Protein 88, RNF88) Antibody 100ug 735 € MBS Polyclonals_1 human
SP-100078-5 Platelet Factor 4, PF4, PF4 (58-70) (human) 5 mg 333 € adi human
GENTAUR-58be31bbb4dcf CCR8, loop2 (chemokine receptor 8, C-C chemokine receptor type 8, CC-CKR-8, C-C CKR-8, CCR-8, CDw198, Chemokine receptor-like 1, CKRL1) Antibody 100ul 707 € MBS mono human
MBS611205 LEC, NCC-4 (Liver-Expressed Chemokine, New Chemokine CC-4, Small Inducible Cytokine Subfamily A (Cys X Cys) member 16, SCYA16, IL-10-inducible Chemokine, Monotactin-1) Antibody 50ug 625 € MBS Polyclonals_1 human
MBS619083 BCA-1 (B Cell Attracting Chemokine 1, BCA1, B Lymphocyte Chemoattractant, ANGIE, ANGIE2, BLC, BLR1 Ligand, BLR1L, Chemokine (C-X-C Motif) Ligand 13 (B-cell Chemoattractant), C-X-C Motif Chemokine 13, CXCL13, CXC Chemokine BLC, Small Inducible Cytokine B S Antibody 50ug 774 € MBS Polyclonals_1 human
MBS623554 CCR7 (C-C Chemokine Receptor Type 7, Chemokine (C-C Motif) Receptor 7, C-C CKR-7, CC-CKR-7, CCR-7, BLR2, CD197, CDw197, CMKBR7, Epstein-Barr Virus-induced G-protein Coupled Receptor 1, EBV Induced G Protein Coupled Receptor 1, EBI1, EVI1, MIP-3 beta Recep Antibody 100ug 619 € MBS Polyclonals_1 virus
MBS622999 TRIM3 (Tripartite Motif Containing 3, Tripartite Motif-containing 3, Tripartite Motif Protein TRIM3, Brain Expressed Ring Finger, Brain-expressed Ring Finger, BERP, HAC1, Ring Finger Protein 22, RNF22, Ring Finger Protein 97, RNF97) 100ug 785 € MBS Polyclonals_1 human
MBS621891 TRIM56 (Tripartite Motif Containing 56, Tripartite Motif-containing 56, Tripartite Motif Containing Protein 56, DKFZp667O116, A130009K11Rik, FLJ35608, Gm452, MGC37358, OTTMUSP00000027392, RING Finger Protein 109, RNF109) 100ul 785 € MBS Polyclonals_1 human
GWB-ATG233 CXCL4, 32-101aa, Human, His tag, E.coli, Recombinant Protein bulk Ask price € genways bulk human
GWB-BIG101 Recombinant Human PF-4 (CXCL4) bulk Ask price € genways bulk human
GWB-F19C3B Recombinant Human Platelet Factor-4 (CXCL4) bulk Ask price € genways bulk human
GWB-16A934 Recombinant Human Platelet Factor-4 (CXCL4) Variant-1 500 ug 662 € genways bulk human
abx263239 Anti-Platelet Factor-4 (CXCL4), His Tag Protein (Recombinant) 100 µg 1674 € abbex human
abx261548 Anti-Platelet Factor-4 (CXCL4) Protein (Recombinant) 20 µg 340 € abbex human
abx261741 Anti-Platelet Factor-4 (CXCL4) Protein (Recombinant) 1 mg 3747 € abbex human
ZR-40-104 CXCL4 Recombinant Protein 0.005 mg 256 € Zyagen human