| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
6 kD, 8 |
| UniProt number: |
P02778 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CXCL10, C-X-C Motif Chemokine 10 |
| Short name: |
CXCL10, Recombinant C-X-C Motif Chemokine 10 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
chemokine (C-X-C motif) ligand 10, sapiens C-X-C Motif Chemokine 10, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
C7 and crg-2 and gIP-10 and IFI10 and INP10 and IP-10 and mob-1 and SCYB10, CXCL10 and IDBG-25212 and ENSG00000169245 and 3627, CXCL10 and IDBG-643109 and ENSBTAG00000001725 and 615107, CXCR3 chemokine receptor binding, Cxcl10 and IDBG-179916 and ENSMUSG00000034855 and 15945, Extracellular, this GO :0002690 and positive regulation of leukocyte chemotaxis and biological process this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007517 and muscle organ development and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008015 and blood circulation and biological process this GO :0008201 and heparin binding and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008603 and cAMP-dependent protein kinase regulator activity and molecular function this GO :0009306 and protein secretion and biological process this GO :0009409 and response to cold and biological process this GO :0009615 and response to virus and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0010332 and response to gamma radiation and biological process this GO :0010818 and T cell chemotaxis and biological process this GO :0010996 and response to auditory stimulus and biological process this GO :0016525 and negative regulation of angiogenesis and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030816 and positive regulation of cAMP metabolic process and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0033280 and response to vitamin D and biological process this GO :0034605 and cellular response to heat and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0043950 and positive regulation of cAMP-mediated signaling and biological process this GO :0045087 and innate immune response and biological process this GO :0045859 and regulation of protein kinase activity and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048248 and CXCR3 chemokine receptor binding and molecular function this GO :0051281 and positive regulation of release of sequestered calcium ion into cytosol and biological process this GO :0051607 and defense response to virus and biological process this GO :0070098 and chemokine-mediated signaling pathway and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :2000406 and positive regulation of T cell migration and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005515 : protein binding and also this GO :0008009 : chemokine activity and also this GO :0008201 : heparin binding and also this GO :0008603 : cAMP-dependent protein kinase regulator activity and also this GO :0048248 : CXCR3 chemokine receptor binding, this GO :0005515 : protein binding, this GO :0008009 : chemokine activity, this GO :0008201 : heparin binding, this GO :0008603 : cAMP-dependent protein kinase regulator activity, this GO :0048248 : CXCR3 chemokine receptor binding, chemokine (C-X-C motif) ligand 10 |
| Identity: |
10637 |
| Gene: |
CXCL10 |
More about : CXCL10 |
| Long gene name: |
C-X-C motif chemokine ligand 10 |
| Synonyms gene: |
INP10 SCYB10 |
| Synonyms gene name: |
member 10 chemokine (C-X-C motif) ligand 10 , small inducible cytokine subfamily B (Cys-X-Cys) |
| Synonyms: |
IFI10 IP-10 crg-2 mob-1 C7 gIP-10 |
| Locus: |
4q21, 1 |
| Discovery year: |
1999-12-09 |
| GenBank acession: |
X02530 |
| Entrez gene record: |
3627 |
| Pubmed identfication: |
2437586 3925348 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000160887 |