Recombinant Human Interleukin-8, IL-8 (Ser28-Ser99)

Catalog number:	C035 Buy Now
Price:	368 €
Supplier:	Bioss Primary Conjugated Antibodies
Product name:	Recombinant Human Interleukin-8, IL-8 (Ser28-Ser99)
Quantity:	0.1ml
Other quantities:	1 mg 1836€ 50 µg 354€ 500 µg 1298€
Related search:	human gene interleukin recombinant chemotactic neutrophil kits

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Interleukin-8 is produced by our E, coli expression system and the target gene encoding Ser28-Ser99 is expressed
Molecular Weight:	45 kD, 8
UniProt number:	P10145
State of the product:	Freeze-dried
Shipping conditions:	Ambient temperature
Formulation:	150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations:	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution:	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	IL-8 (Ser28-Ser99), Interleukin-8
Short name:	IL-8 (Ser28-Ser99), Recombinant Interleukin-8
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	Interleukin-8 (Ser28-Ser99), sapiens Interleukin-8, recombinant H
Alternative technique:	rec
Identity:	6025
Gene:	CXCL8 | More about : CXCL8
Long gene name:	C-X-C motif chemokine ligand 8
Synonyms gene:	IL8
Synonyms gene name:	interleukin 8 chemokine (C-X-C motif) ligand 8
Synonyms:	SCYB8 LUCT LECT MDNCF TSG-1 IL-8 NAP-1 3-10C MONAP AMCF-I LYNAP NAF b-ENAP GCP-1 K60 GCP1 NAP1
Synonyms name:	neutrophil-activating peptide 1 granulocyte chemotactic protein 1 monocyte-derived neutrophil chemotactic factor lung giant cell carcinoma-derived chemotactic protein tumor necrosis factor-induced gene 1 monocyte-derived neutrophil-activating peptide lymphocyte derived neutrophil activating peptide beta endothelial cell-derived neutrophil activating peptide alveolar macrophage chemotactic factor I
Locus:	4q13, 3
Discovery year:	1989-06-30
GenBank acession:	Y00787
Entrez gene record:	3576
Pubmed identfication:	1427896 11178128
RefSeq identity:	NM_000584
Classification:	Endogenous ligands Chemokine ligands Interleukins
Havana BLAST/BLAT:	OTTHUMG00000151316

• #human
• #gene
• #interleukin
• #recombinant
• #chemotactic
• #neutrophil
• #kits