| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Interleukin-8 is produced by our E, coli expression system and the target gene encoding Ala23-Ser99 is expressed |
| Molecular Weight: |
8, 9 kD |
| UniProt number: |
P10145 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
IL-8 (Ala23-Ser99), Interleukin-8 |
| Short name: |
IL-8 (Ala23-Ser99), Recombinant Interleukin-8 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Interleukin-8 (Ala23-Ser99), sapiens Interleukin-8, recombinant H |
| Alternative technique: |
rec |
| Identity: |
6025 |
| Gene: |
CXCL8 |
More about : CXCL8 |
| Long gene name: |
C-X-C motif chemokine ligand 8 |
| Synonyms gene: |
IL8 |
| Synonyms gene name: |
interleukin 8 chemokine (C-X-C motif) ligand 8 |
| Synonyms: |
SCYB8 LUCT LECT MDNCF TSG-1 IL-8 NAP-1 3-10C MONAP AMCF-I LYNAP NAF b-ENAP GCP-1 K60 GCP1 NAP1 |
| Synonyms name: |
neutrophil-activating peptide 1 granulocyte chemotactic protein 1 monocyte-derived neutrophil chemotactic factor lung giant cell carcinoma-derived chemotactic protein tumor necrosis factor-induced gene 1 monocyte-derived neutrophil-activating peptide lymphocyte derived neutrophil activating peptide beta endothelial cell-derived neutrophil activating peptide alveolar macrophage chemotactic factor I |
| Locus: |
4q13, 3 |
| Discovery year: |
1989-06-30 |
| GenBank acession: |
Y00787 |
| Entrez gene record: |
3576 |
| Pubmed identfication: |
1427896 11178128 |
| RefSeq identity: |
NM_000584 |
| Classification: |
Endogenous ligands Chemokine ligands Interleukins |
| Havana BLAST/BLAT: |
OTTHUMG00000151316 |