| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
AMHR2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
5-1ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This AMHR2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q16671 |
| Purity: |
Antigen affinity |
| Description: |
AMH and testosterone are produced in the testes by different cells and have different effects, Alternatively spliced transcript variants encoding different isoforms have been identified, Mutations in this gene are associated with persistent Mullerian duct syndrome type II, Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes, in addition to testosterone, results in male sex differentiation, AMHR2 is the receptor for the anti-Mullerian hormone (AMH) which |
| Immunogen: |
Amino acids QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE were used as the immunogen for the AMHR2 antibody |
| Storage: |
After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the AMHR2 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
AMHR2 |
| Short name: |
AMHR2 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
classification II (Antibody to), antibody to-Mullerian hormone receptor |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
AMHR and MISR2 and MISRII and MRII, AMHR2 and IDBG-36672 and ENSG00000135409 and 269, AMHR2 and IDBG-631327 and ENSBTAG00000018524 and, Amhr2 and IDBG-188637 and ENSMUSG00000023047 and 110542, Plasma membranes, this GO :0001880 and Mullerian duct regression and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004675 and transmembrane receptor protein serine/threonine kinase activity and molecular function this GO :0004702 and receptor signaling protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005024 and transforming growth factor beta-activated receptor activity and molecular function this GO :0005026 and transforming growth factor beta receptor activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity and also this GO :0004702 : receptor signaling protein serine/threonine kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0004872 : receptor activity and also this GO :0005024 : transforming growth factor beta-activated receptor activity and also this GO :0005026 : transforming growth factor beta receptor activity, this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity, this GO :0004702 : receptor signaling protein serine/threonine kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004872 : receptor activity, this GO :0005024 : transforming growth factor beta-activated receptor activity, this GO :0005026 : transforming growth factor beta receptor activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0016772 : transferase activity, this GO :0042562 : hormone binding, this GO :0046872 : metal ion binding, this GO :1990272 : anti-Mullerian hormone receptor activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0042562 : hormone binding and also this GO :0046872 : metal ion binding and also this GO :1990272 : anti-Mullerian hormone receptor activity, transferring phosphorus-containing groups and molecular function this GO :0023014 and signal transduction by phosphorylation and biological process this GO :0042562 and hormone binding and molecular function this GO :0046872 and metal ion binding and molecular function this GO :1902613 and negative regulation of anti-Mullerian hormone signaling pathway and biological process this GO :1990262 and anti-Mullerian hormone signaling pathway and biological process this GO :1990272 and anti-Mullerian hormone receptor activity and molecular function, transforming growth factor beta receptor activity, type II, type II, type II and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016772 : transferase activity, type II and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0007165 and signal transduction and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007548 and sex differentiation and biological process this GO :0016020 and membrane and cellular component this GO :0016772 and transferase activity, anti-Mullerian hormone receptor |
| Identity: |
465 |
| Gene: |
AMHR2 |
More about : AMHR2 |
| Long gene name: |
anti-Mullerian hormone receptor type 2 |
| Synonyms gene name: |
anti-Mullerian hormone receptor type II |
| Synonyms: |
MISR2 MISRII |
| Synonyms name: |
Muellerian inhibiting substance type II receptor |
| Locus: |
12q13, 13 |
| Discovery year: |
1997-07-22 |
| GenBank acession: |
AF172932 |
| Entrez gene record: |
269 |
| Pubmed identfication: |
7493017 |
| RefSeq identity: |
NM_020547 |
| Classification: |
Type 2 receptor serine/threonine kinases |
| Havana BLAST/BLAT: |
OTTHUMG00000170048 |