AMHR2 Antibody

Contact us
Catalog number: R32469
Price: 600 €
Supplier: ABM lentivectors
Product name: AMHR2 Antibody
Quantity: 1.0 µg DNA
Other quantities: 0.1mg 406€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: AMHR2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 5-1ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This AMHR2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q16671
Purity: Antigen affinity
Description: AMH and testosterone are produced in the testes by different cells and have different effects, Alternatively spliced transcript variants encoding different isoforms have been identified, Mutations in this gene are associated with persistent Mullerian duct syndrome type II, Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes, in addition to testosterone, results in male sex differentiation, AMHR2 is the receptor for the anti-Mullerian hormone (AMH) which
Immunogen: Amino acids QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE were used as the immunogen for the AMHR2 antibody
Storage: After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the AMHR2 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: AMHR2
Short name: AMHR2 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: classification II (Antibody to), antibody to-Mullerian hormone receptor
Alternative technique: antibodies
Alternative to gene target: AMHR and MISR2 and MISRII and MRII, AMHR2 and IDBG-36672 and ENSG00000135409 and 269, AMHR2 and IDBG-631327 and ENSBTAG00000018524 and, Amhr2 and IDBG-188637 and ENSMUSG00000023047 and 110542, Plasma membranes, this GO :0001880 and Mullerian duct regression and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004675 and transmembrane receptor protein serine/threonine kinase activity and molecular function this GO :0004702 and receptor signaling protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005024 and transforming growth factor beta-activated receptor activity and molecular function this GO :0005026 and transforming growth factor beta receptor activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity and also this GO :0004702 : receptor signaling protein serine/threonine kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0004872 : receptor activity and also this GO :0005024 : transforming growth factor beta-activated receptor activity and also this GO :0005026 : transforming growth factor beta receptor activity, this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity, this GO :0004702 : receptor signaling protein serine/threonine kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004872 : receptor activity, this GO :0005024 : transforming growth factor beta-activated receptor activity, this GO :0005026 : transforming growth factor beta receptor activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0016772 : transferase activity, this GO :0042562 : hormone binding, this GO :0046872 : metal ion binding, this GO :1990272 : anti-Mullerian hormone receptor activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0042562 : hormone binding and also this GO :0046872 : metal ion binding and also this GO :1990272 : anti-Mullerian hormone receptor activity, transferring phosphorus-containing groups and molecular function this GO :0023014 and signal transduction by phosphorylation and biological process this GO :0042562 and hormone binding and molecular function this GO :0046872 and metal ion binding and molecular function this GO :1902613 and negative regulation of anti-Mullerian hormone signaling pathway and biological process this GO :1990262 and anti-Mullerian hormone signaling pathway and biological process this GO :1990272 and anti-Mullerian hormone receptor activity and molecular function, transforming growth factor beta receptor activity, type II, type II, type II and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016772 : transferase activity, type II and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0007165 and signal transduction and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007548 and sex differentiation and biological process this GO :0016020 and membrane and cellular component this GO :0016772 and transferase activity, anti-Mullerian hormone receptor
Identity: 465
Gene: AMHR2 | More about : AMHR2
Long gene name: anti-Mullerian hormone receptor type 2
Synonyms gene name: anti-Mullerian hormone receptor type II
Synonyms: MISR2 MISRII
Synonyms name: Muellerian inhibiting substance type II receptor
Locus: 12q13, 13
Discovery year: 1997-07-22
GenBank acession: AF172932
Entrez gene record: 269
Pubmed identfication: 7493017
RefSeq identity: NM_020547
Classification: Type 2 receptor serine/threonine kinases
Havana BLAST/BLAT: OTTHUMG00000170048

Related Products :

GWB-MR543C Amhr2 antibody 1 vial 521 € genways human
R32469 AMHR2 Antibody 0.1mg 406 € NJS poly human
R33995-100UG AMHR2 Antibody 0.1mg 406 € NJS poly human
R34253-100UG AMHR2 Antibody 0.1mg 406 € NJS poly human
GENTAUR-58be15835cd32 Anti- AMHR2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be1583e0233 Anti- AMHR2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be55ab3e363 Anti- AMHR2 Antibody 100ug 387 € MBS Polyclonals human
GENTAUR-58be55ab8e53f Anti- AMHR2 Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be55abc9b1c Anti- AMHR2 Antibody 50ug 304 € MBS Polyclonals human
AP13727PU-N anti-AMHR2 (C-term) Antibody 0,4 ml 587 € acr human
AP13725PU-N anti-AMHR2 (N-term) Antibody 0,4 ml 587 € acr human
AP13726PU-N anti-AMHR2 (N-term) Antibody 0,4 ml 587 € acr human
bs-12414R-A350 MISRII/AMHR2 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12414R-A488 MISRII/AMHR2 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12414R-A555 MISRII/AMHR2 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12414R-A594 MISRII/AMHR2 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12414R-A647 MISRII/AMHR2 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12414R-Biotin MISRII/AMHR2 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-12414R MISRII/AMHR2 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-12414R-Cy3 MISRII/AMHR2 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-12414R-Cy5 MISRII/AMHR2 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-12414R-Cy5.5 MISRII/AMHR2 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-12414R-Cy7 MISRII/AMHR2 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-12414R-FITC MISRII/AMHR2 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-12414R-HRP MISRII/AMHR2 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
LV794307 AMHR2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 600 € ABM lentivectors human
LV794308 AMHR2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 600 € ABM lentivectors human
LV794309 AMHR2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 600 € ABM lentivectors human
LV794312 AMHR2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 600 € ABM lentivectors human
LV794311 AMHR2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 600 € ABM lentivectors human