| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
UHRF1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the UHRF1 antibody should be determined by the researcher |
| Intented use: |
This UHRF1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q96T88 |
| Purity: |
Antigen affinity |
| Description: |
1 is a protein which in humans is encoded by the UHRF1 gene, A related pseudogene exists on chromosome 12, It is regarded as a hub protein for the integration of epigenetic information, It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle, Multiple transcript variants encoding different isoforms have been found for this gene, The protein binds to specific DNA sequences, This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases, This gene is up-regulated in various cancers, and functions in the p53-dependent DNA damage checkpoint, and it is therefore considered to be a therapeutic target, and recruits a histone deacetylase to regulate gene expression, containing PHD and RING finger domains, Ubiquitin-like |
| Immunogen: |
Amino acids HTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ of human UHRF1 were used as the immunogen for the UHRF1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the UHRF1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
UHRF1 |
| Short name: |
UHRF1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
UHRF1 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
12556 |
| Gene: |
UHRF1 |
More about : UHRF1 |
| Long gene name: |
ubiquitin like with PHD and ring finger domains 1 |
| Synonyms: |
ICBP90 Np95 FLJ21925 RNF106 TDRD22 |
| Locus: |
19p13, 3 |
| Discovery year: |
2000-03-15 |
| GenBank acession: |
AF129507 |
| Entrez gene record: |
29128 |
| Pubmed identfication: |
10646863 |
| RefSeq identity: |
NM_001048201 |
| Classification: |
PHD finger proteins Ring finger proteins Tudor domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000180251 |