FMRP Antibody / FMR1

Contact us
Catalog number: R32195
Price: 393 €
Supplier: MBS Polyclonals
Product name: FMRP Antibody / FMR1
Quantity: 100ug
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: FMRP / FMR1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the FMRP antibody should be determined by the researcher
Intented use: This FMRP antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q06787
Purity: Antigen affinity
Description: A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, Additionally, Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1), Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene, Mutations of this gene can lead to fragile X syndrome, Parkinson's disease, The protein encoded by this gene binds RNA and is associated with polysomes, This protein, autism, but an expansion to 55-230 repeats is the cause of fragile X syndrome, developmental delays and other cognitive deficits, is essential for normalcognitive developmentand female reproductive function, mental retardation, most commonly found in the brain, or FMRP, premature ovarian failure, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm, FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mental retardation protein
Immunogen: Amino acids ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM of human FMRP were used as the immunogen for the FMRP antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the FMRP antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: FMRP / FMR1
Short name: FMRP Antibody / FMR1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: FMRP (Antibody to) / FMR1
Alternative technique: antibodies
Identity: 3775
Gene: FMR1 | More about : FMR1
Long gene name: fragile X mental retardation 1
Synonyms gene: POF1 POF
Synonyms gene name: premature ovarian failure 1
Synonyms: FMRP FRAXA MGC87458
Locus: Xq27, 3
Discovery year: 1992-01-17
GenBank acession: X69962
Entrez gene record: 2332
Pubmed identfication: 1572655
RefSeq identity: NM_002024
Havana BLAST/BLAT: OTTHUMG00000022606
Locus Specific Databases: Mental Retardation database LRG_762

Related Products :

AP23068PU-N anti-FMR1 / FMRP (116-130) Antibody 50 Вµg 732 € acr human
AP23051PU-N anti-FMR1 / FMRP (594-607) Antibody 50 Вµg 732 € acr human
AM06321SU-N anti-FMR1 / FMRP Antibody 0,1 ml 630 € acr human
R32195 FMRP Antibody / FMR1 0.1mg 406 € NJS poly human
MBS243920 Goat Polyclonal to Human FMR1 / FMRP Antibody 50ug 597 € MBS Polyclonals_1 human
MBS244746 Goat Polyclonal to Human FMR1 / FMRP Antibody 50ug 597 € MBS Polyclonals_1 human
bs-13188R-A350 FMRP (Ser500) Antibody, ALEXA FLUOR 350 100ul 350 € Bioss Primary Conjugated Antibodies. human
bs-13188R-A488 FMRP (Ser500) Antibody, ALEXA FLUOR 488 100ul 350 € Bioss Primary Conjugated Antibodies. human
bs-13188R-A555 FMRP (Ser500) Antibody, ALEXA FLUOR 555 100ul 350 € Bioss Primary Conjugated Antibodies. human
bs-13188R-A594 FMRP (Ser500) Antibody, ALEXA FLUOR 594 100ul 350 € Bioss Primary Conjugated Antibodies. human
bs-13188R-A647 FMRP (Ser500) Antibody, ALEXA FLUOR 647 100ul 350 € Bioss Primary Conjugated Antibodies. human
bs-13188R-Biotin FMRP (Ser500) Antibody, Biotin Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-13188R FMRP (Ser500) Antibody 0.1ml 281 € Bioss Primary Unconjugated Antibodies human
bs-13188R-Cy3 FMRP (Ser500) Antibody, Cy3 Conjugated 0.1ml 368 € Bioss Primary Conjugated Antibodies human
bs-13188R-Cy5 FMRP (Ser500) Antibody, Cy5 Conjugated 0.1ml 368 € Bioss Primary Conjugated Antibodies human
bs-13188R-Cy5.5 FMRP (Ser500) Antibody, Cy5.5 Conjugated 0.1ml 368 € Bioss Primary Conjugated Antibodies human
bs-13188R-Cy7 FMRP (Ser500) Antibody, Cy7 Conjugated 0.1ml 368 € Bioss Primary Conjugated Antibodies human
bs-13188R-FITC FMRP (Ser500) Antibody, FITC Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-13188R-HRP FMRP (Ser500) Antibody, HRP Conjugated 0.1ml 368 € Bioss Primary Conjugated Antibodies human
GENTAUR-58be5d47c8851 Anti-FMRP (Ser500) (Polyclonal), ALEXA Fluor 594 100 microliters 516 € Bioss Polyclonal Antibodies human
GENTAUR-58bdfb60e4f03 Anti- FMR1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfb6151f78 Anti- FMR1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfbbb9d4ca Anti- FMR1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfbbc59179 Anti- FMR1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be06c07004c Anti- FMR1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be06c0cc694 Anti- FMR1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be07b3a8cc6 Anti- FMR1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be07b4064bd Anti- FMR1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be3b8a03fdc Anti- FMR1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be440841a6b Anti- FMR1 Antibody 100ug 393 € MBS Polyclonals human