| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
SHP2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the SHP-2 antibody should be determined by the researcher |
| Intented use: |
This SHP-2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q06124 |
| Purity: |
Antigen affinity |
| Description: |
BPTP3, Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia, PTPN11 is a member of the protein tyrosine phosphatase (PTP) family, PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, SH-PTP2, SH-PTP3, SHP-2, TYROSINE PHOSPHATASE SHP2 (SHP2), The open reading frame consists of 1, This PTP contains two tandem Src homology-2 domains, This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, also known as protein-tyrosine phosphatase 1D (PTP-1D), and cell migration, and oncogenic transformation, differentiation, is an enzyme that in humans is encoded by the PTPN11 gene, metabolic control, mitotic cycle, protein-tyrosine phosphatase 2C (PTP-2C), such as mitogenic activation, transcription regulation, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates, 779 nucleotides potentially encoding a protein of 593 amino acids with a predicted molecular mass of 68 kD, PTPN11 (Tyrosine-protein phosphatase non-receptor type 11) |
| Immunogen: |
Amino acids EKFATLAELVQYYMEHHGQLKEKNGDVIELK of human SHP2/PTPN11 were used as the immunogen for the SHP-2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SHP-2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
SHP2 |
| Short name: |
SHP2 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
SHP2 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
9644 |
| Gene: |
PTPN11 |
More about : PTPN11 |
| Long gene name: |
non-receptor type 11 , protein tyrosine phosphatase |
| Synonyms gene: |
NS1 |
| Synonyms gene name: |
Noonan syndrome 1 |
| Synonyms: |
BPTP3 SH-PTP2 SHP-2 PTP2C SHP2 |
| Locus: |
12q24, 13 |
| Discovery year: |
1993-03-03 |
| GenBank acession: |
D13540 |
| Entrez gene record: |
5781 |
| Pubmed identfication: |
7894486 1280823 |
| Classification: |
Protein tyrosine phosphatases, non-receptor type SH2 domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000134334 |
| Locus Specific Databases: |
LRG_614 |