SHP2 Antibody

Contact us
Catalog number: R32193
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: SHP2 Antibody
Quantity: 0.1ml
Other quantities: 0.08 ml 199€ 0.1mg 389€ 0.4 ml 406€ 100ug 431€ 100ul 426€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: SHP2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the SHP-2 antibody should be determined by the researcher
Intented use: This SHP-2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q06124
Purity: Antigen affinity
Description: BPTP3, Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia, PTPN11 is a member of the protein tyrosine phosphatase (PTP) family, PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, SH-PTP2, SH-PTP3, SHP-2, TYROSINE PHOSPHATASE SHP2 (SHP2), The open reading frame consists of 1, This PTP contains two tandem Src homology-2 domains, This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, also known as protein-tyrosine phosphatase 1D (PTP-1D), and cell migration, and oncogenic transformation, differentiation, is an enzyme that in humans is encoded by the PTPN11 gene, metabolic control, mitotic cycle, protein-tyrosine phosphatase 2C (PTP-2C), such as mitogenic activation, transcription regulation, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates, 779 nucleotides potentially encoding a protein of 593 amino acids with a predicted molecular mass of 68 kD, PTPN11 (Tyrosine-protein phosphatase non-receptor type 11)
Immunogen: Amino acids EKFATLAELVQYYMEHHGQLKEKNGDVIELK of human SHP2/PTPN11 were used as the immunogen for the SHP-2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SHP-2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: SHP2
Short name: SHP2 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: SHP2 (Antibody to)
Alternative technique: antibodies
Identity: 9644
Gene: PTPN11 | More about : PTPN11
Long gene name: non-receptor type 11 , protein tyrosine phosphatase
Synonyms gene: NS1
Synonyms gene name: Noonan syndrome 1
Synonyms: BPTP3 SH-PTP2 SHP-2 PTP2C SHP2
Locus: 12q24, 13
Discovery year: 1993-03-03
GenBank acession: D13540
Entrez gene record: 5781
Pubmed identfication: 7894486 1280823
Classification: Protein tyrosine phosphatases, non-receptor type SH2 domain containing
Havana BLAST/BLAT: OTTHUMG00000134334
Locus Specific Databases: LRG_614

Related Products :

GWB-6D9C3B protein Tyrosine Phosphatase SHP2 (PTPN11) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 tube 602 € genways human
GWB-E5A520 protein Tyrosine Phosphatase SHP2 (PTPN11) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 vial 602 € genways human
GENTAUR-58be3cd1ef3ea Anti- SHP2 Antibody 100ug 393 € MBS Polyclonals human
MBS421493 Goat anti-SHP2 / PTPN11 Antibody 100ug 370 € MBS Polyclonals_1 human
F48628-0.4ML Phospho-SHP2 Antibody (pY584) 0.4 ml 406 € NJS poly human
bsm-50243M SHP2 (5F2) Monoclonal Antibody 0.1ml 362 € Bioss Primary Unconjugated Antibodies human
F51157-0.08ML SHP2 Antibody 0.08 ml 199 € NJS poly human
F51157-0.4ML SHP2 Antibody 0.4 ml 406 € NJS poly human
F53772-0.4ML SHP2 Antibody 0.4 ml 406 € NJS poly human
GENTAUR-58be39b045604 SHP2 antibody 100ul 498 € MBS mono human
MBS150386 SHP2 Antibody 100ug 431 € MBS Polyclonals_1 human
MBS150624 SHP2 Antibody 100ug 431 € MBS Polyclonals_1 human
MBS270222 SHP2 antibody 100ul 426 € MBS Polyclonals_1 human
R30279 SHP2 Antibody 0.1mg 389 € NJS poly human
R30959 SHP2 Antibody 0.1mg 389 € NJS poly human
R32193 SHP2 Antibody 0.1mg 406 € NJS poly human
R36361-100UG SHP2 Antibody 0.1mg 406 € NJS poly human
GWB-D96B80 SHP2 antibody (C-terminus) 1 vial 470 € genways human
MBS274628 SHP2 antibody [N1N3] 100ul 426 € MBS Polyclonals_1 human
GWB-711C85 SHP2 antibody (phospho Ser576) 1 tube 591 € genways human
GWB-681DFE SHP2 antibody (phospho Tyr542) 1 tube 591 € genways human
F48628-0.08ML SHP2 Antibody (phospho-Y584) 0.08 ml 199 € NJS poly human
SIG-3901 SHP2 Rabbit Polyclonal Antibody 0.1 mg 442 € Zyagen human
SIG-3903 SHP2 Rabbit Polyclonal Antibody 0.1 mg 442 € Zyagen human
bs-5638R-A350 SHP2 (Tyr81) Antibody, ALEXA FLUOR 350 100ul 350 € Bioss Primary Conjugated Antibodies. human
bs-5638R-A488 SHP2 (Tyr81) Antibody, ALEXA FLUOR 488 100ul 350 € Bioss Primary Conjugated Antibodies. human
bs-5638R-A555 SHP2 (Tyr81) Antibody, ALEXA FLUOR 555 100ul 350 € Bioss Primary Conjugated Antibodies. human
bs-5638R-A594 SHP2 (Tyr81) Antibody, ALEXA FLUOR 594 100ul 350 € Bioss Primary Conjugated Antibodies. human
bs-5638R-A647 SHP2 (Tyr81) Antibody, ALEXA FLUOR 647 100ul 350 € Bioss Primary Conjugated Antibodies. human
bs-5638R-Biotin SHP2 (Tyr81) Antibody, Biotin Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human