| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
ICA1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the ICA1 antibody should be determined by the researcher |
| Intented use: |
This ICA1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q05084 |
| Purity: |
Antigen affinity |
| Description: |
It is mapped to 7p22, Several transcript variants encoding two different isoforms have been found for this gene, This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules, What&rsquo, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome, Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene, s more |
| Immunogen: |
Amino acids EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK of human ICA1 were used as the immunogen for the ICA1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ICA1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
ICA1 |
| Short name: |
ICA1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
69kDa (Antibody to), islet cell autoantigen 1 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
69kDa, BT, Cell surfaces, ICA1 and IDBG-8551 and ENSG00000003147 and 3382, ICA69 and ICAp69, Ica1 and IDBG-128452 and ENSMUSG00000062995 and 15893, protein domain specific binding, this GO :0000139 and this GO lgi membrane and cellular component this GO :0003674 and molecular function and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006836 and neurotransmitter transport and biological process this GO :0019904 and protein domain specific binding and molecular function this GO :0030054 and cell junction and cellular component this GO :0030658 and transport vesicle membrane and cellular component this GO :0030667 and secretory granule membrane and cellular component this GO :0030672 and synaptic vesicle membrane and cellular component, this GO :0003674 : molecular_function, this GO :0003674 : molecular_function and also this GO :0019904 : protein domain specific binding, this GO :0019904 : protein domain specific binding, 35115 and IDBG-629525 and ENSBTAG00000000799 and 535346, islet cell autoantigen 1 |
| Identity: |
5343 |
| Gene: |
ICA1 |
More about : ICA1 |
| Long gene name: |
islet cell autoantigen 1 |
| Synonyms gene name: |
69kDa , islet cell autoantigen 1 (69kD) islet cell autoantigen 1 |
| Synonyms: |
ICAp69 ICA69 |
| Locus: |
7p21, 3 |
| Discovery year: |
1992-08-24 |
| Entrez gene record: |
3382 |
| Pubmed identfication: |
7918678 8777998 |
| RefSeq identity: |
NM_004968 |
| Classification: |
Classical BAR domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000152008 |