ICA1 Antibody

Contact us
Catalog number: R32190
Price: 528 €
Supplier: abbex
Product name: ICA1 Antibody
Quantity: 15 nmol
Other quantities: 0.1ml 263€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: ICA1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the ICA1 antibody should be determined by the researcher
Intented use: This ICA1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q05084
Purity: Antigen affinity
Description: It is mapped to 7p22, Several transcript variants encoding two different isoforms have been found for this gene, This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules, What&rsquo, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome, Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene, s more
Immunogen: Amino acids EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK of human ICA1 were used as the immunogen for the ICA1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ICA1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: ICA1
Short name: ICA1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: 69kDa (Antibody to), islet cell autoantigen 1
Alternative technique: antibodies
Alternative to gene target: 69kDa, BT, Cell surfaces, ICA1 and IDBG-8551 and ENSG00000003147 and 3382, ICA69 and ICAp69, Ica1 and IDBG-128452 and ENSMUSG00000062995 and 15893, protein domain specific binding, this GO :0000139 and this GO lgi membrane and cellular component this GO :0003674 and molecular function and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006836 and neurotransmitter transport and biological process this GO :0019904 and protein domain specific binding and molecular function this GO :0030054 and cell junction and cellular component this GO :0030658 and transport vesicle membrane and cellular component this GO :0030667 and secretory granule membrane and cellular component this GO :0030672 and synaptic vesicle membrane and cellular component, this GO :0003674 : molecular_function, this GO :0003674 : molecular_function and also this GO :0019904 : protein domain specific binding, this GO :0019904 : protein domain specific binding, 35115 and IDBG-629525 and ENSBTAG00000000799 and 535346, islet cell autoantigen 1
Identity: 5343
Gene: ICA1 | More about : ICA1
Long gene name: islet cell autoantigen 1
Synonyms gene name: 69kDa , islet cell autoantigen 1 (69kD) islet cell autoantigen 1
Synonyms: ICAp69 ICA69
Locus: 7p21, 3
Discovery year: 1992-08-24
Entrez gene record: 3382
Pubmed identfication: 7918678 8777998
RefSeq identity: NM_004968
Classification: Classical BAR domain containing
Havana BLAST/BLAT: OTTHUMG00000152008

Related Products :

GENTAUR-58be13e0bb5af Anti- ICA1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be13e12ca20 Anti- ICA1 Antibody 0.12 ml 348 € MBS Polyclonals human
abx145248 Anti-ICA1 Antibody inquire 50 € abbex human
GENTAUR-58bdc234f04de Anti- Islet Cell Autoantigen 1 (ICA1) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc23557671 Anti- Islet Cell Autoantigen 1 (ICA1) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc7e074687 Anti- Islet Cell Autoantigen 1 (ICA1) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc929b4cab Anti- Islet Cell Autoantigen 1 (ICA1) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd10797cbc Anti- Islet Cell Autoantigen 1 (ICA1) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd107f0078 Anti- Islet Cell Autoantigen 1 (ICA1) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdd7203974b Anti- Islet Cell Autoantigen 1 (ICA1) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bddcba7ffc3 Anti- Islet Cell Autoantigen 1 (ICA1) Antibody 100ug 575 € MBS Polyclonals human
AP52139PU-N anti-Islet cell autoantigen 1 / ICA1 (N-term) Antibody 0,4 ml 587 € acr human
GWB-MT523A ICA1 antibody 1 vial 521 € genways human
GWB-MT524B ICA1 antibody 1 vial 521 € genways human
R32190 ICA1 Antibody 0.1mg 406 € NJS poly human
bs-11349R-A350 ICA1 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11349R-A488 ICA1 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11349R-A555 ICA1 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11349R-A594 ICA1 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11349R-A647 ICA1 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11349R-Biotin ICA1 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11349R ICA1 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-11349R-Cy3 ICA1 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11349R-Cy5 ICA1 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11349R-Cy5.5 ICA1 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11349R-Cy7 ICA1 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11349R-FITC ICA1 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11349R-HRP ICA1 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
GENTAUR-58be5b16a02cd Anti-ICA1 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx920107 Anti-ICA1 siRNA 15 nmol 528 € abbex human