| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
TAP1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the TAP1 antibody should be determined by the researcher |
| Intented use: |
This TAP1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q03518 |
| Purity: |
Antigen affinity |
| Description: |
ABC proteins transport various molecules across extra- and intra-cellular membranes, ALD, And ABC genes are divided into seven distinct subfamilies (ABC1, GCN20, MDR/TAP, MRP, Members of the MDR/TAP subfamily are involved in multidrug resistance, Mutations in this gene may be associated with ankylosing spondylitis, OABP, The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters, The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble, This protein is a member of the MDR/TAP subfamily, Two transcript variants encoding different isoforms have been found for this gene, White), and celiac disease, insulin-dependent diabetes mellitus, Transporter associated with Antigen Processing 1 is a protein that in humans is encoded by the TAP1 gene |
| Immunogen: |
Amino acids RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN of human TAP1 were used as the immunogen for the TAP1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the TAP1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
TAP1 |
| Short name: |
TAP1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
adenosine triphosphate-binding cassette, sub-family B (multi-drug-resistant/TAP) (Antibody to), transporter 1 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
ABC17 and ABCB2 and APT1 and D6S114E and PSF-1 and PSF1 and RING4 and TAP1*0102N and TAP1N, ATP-binding cassette, ATPase activity, Plasma membranes, TAP-dependent and biological process this GO :0005215 and transporter activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005739 and mitochondrion and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0006200 and ATP catabolic process and biological process this GO :0006810 and transport and biological process this GO :0006952 and defense response and biological process this GO :0015197 and peptide transporter activity and molecular function this GO :0015833 and peptide transport and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016887 and ATPase activity and molecular function this GO :0019060 and intracellular transport of viral protein in host cell and biological process this GO :0019885 and antigen processing and presentation of endogenous peptide antigen via MHC class I and biological process this GO :0023029 and MHC class Ib protein binding and molecular function this GO :0030176 and integral component of endoplasmic reticulum membrane and cellular component this GO :0042288 and MHC class I protein binding and molecular function this GO :0042590 and antigen processing and presentation of exogenous peptide antigen via MHC class I and biological process this GO :0042605 and peptide antigen binding and molecular function this GO :0042626 and ATPase activity, TAP1 and IDBG-628856 and ENSBTAG00000008953 and 524959, TAP1 and IDBG-81568 and ENSG00000168394 and 6890, Tap1 and IDBG-170616 and ENSMUSG00000037321 and 21354, coupled to transmembrane movement of substances, coupled to transmembrane movement of substances and also this GO :0042803 : protein homodimerization activity and also this GO :0043531 : ADP binding and also this GO :0046978 : TAP1 binding and also this GO :0046979 : TAP2 binding, coupled to transmembrane movement of substances and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0042825 and TAP complex and cellular component this GO :0043531 and ADP binding and molecular function this GO :0046967 and cytosol to ER transport and biological process this GO :0046978 and TAP1 binding and molecular function this GO :0046979 and TAP2 binding and molecular function this GO :0055085 and transmembrane transport and biological process, sub-family B (MDR/TAP), this GO :0002474 and antigen processing and presentation of peptide antigen via MHC class I and biological process this GO :0002479 and antigen processing and presentation of exogenous peptide antigen via MHC class I, this GO :0005215 : transporter activity, this GO :0005215 : transporter activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0015197 : peptide transporter activity and also this GO :0016887 : ATPase activity and also this GO :0023029 : MHC class Ib protein binding and also this GO :0042288 : MHC class I protein binding and also this GO :0042605 : peptide antigen binding and also this GO :0042626 : ATPase activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0015197 : peptide transporter activity, this GO :0016887 : ATPase activity, this GO :0023029 : MHC class Ib protein binding, this GO :0042288 : MHC class I protein binding, this GO :0042605 : peptide antigen binding, this GO :0042626 : ATPase activity, this GO :0042803 : protein homodimerization activity, this GO :0043531 : ADP binding, this GO :0046978 : TAP1 binding, this GO :0046979 : TAP2 binding, transporter 1 |
| Identity: |
43 |
| Gene: |
TAP1 |
More about : TAP1 |
| Long gene name: |
ATP binding cassette subfamily B member , transporter 1 |
| Synonyms gene: |
ABCB2 |
| Synonyms gene name: |
ATP-binding cassette, sub-family B (MDR/TAP) , transporter 1 |
| Synonyms: |
PSF1 RING4 D6S114E |
| Locus: |
6p21, 32 |
| Discovery year: |
1992-06-25 |
| Entrez gene record: |
6890 |
| Pubmed identfication: |
1529427 1946428 |
| RefSeq identity: |
NM_000593 |
| Classification: |
ATP binding cassette subfamily B |
| Havana BLAST/BLAT: |
OTTHUMG00000031067 |
| Locus Specific Databases: |
TAP1base: Mutation registry for TAP1 deficiency IMGT/HLA Database LRG_166 |