TAP1 Antibody

Contact us
Catalog number: R32188
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: TAP1 Antibody
Quantity: 0.1ml
Other quantities: 0.08 ml 199€ 0.1mg 406€ 0.1ml 263€ 0.4 ml 406€ 1 vial 591€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: TAP1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the TAP1 antibody should be determined by the researcher
Intented use: This TAP1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q03518
Purity: Antigen affinity
Description: ABC proteins transport various molecules across extra- and intra-cellular membranes, ALD, And ABC genes are divided into seven distinct subfamilies (ABC1, GCN20, MDR/TAP, MRP, Members of the MDR/TAP subfamily are involved in multidrug resistance, Mutations in this gene may be associated with ankylosing spondylitis, OABP, The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters, The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble, This protein is a member of the MDR/TAP subfamily, Two transcript variants encoding different isoforms have been found for this gene, White), and celiac disease, insulin-dependent diabetes mellitus, Transporter associated with Antigen Processing 1 is a protein that in humans is encoded by the TAP1 gene
Immunogen: Amino acids RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN of human TAP1 were used as the immunogen for the TAP1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the TAP1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: TAP1
Short name: TAP1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: adenosine triphosphate-binding cassette, sub-family B (multi-drug-resistant/TAP) (Antibody to), transporter 1
Alternative technique: antibodies
Alternative to gene target: ABC17 and ABCB2 and APT1 and D6S114E and PSF-1 and PSF1 and RING4 and TAP1*0102N and TAP1N, ATP-binding cassette, ATPase activity, Plasma membranes, TAP-dependent and biological process this GO :0005215 and transporter activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005739 and mitochondrion and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0006200 and ATP catabolic process and biological process this GO :0006810 and transport and biological process this GO :0006952 and defense response and biological process this GO :0015197 and peptide transporter activity and molecular function this GO :0015833 and peptide transport and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016887 and ATPase activity and molecular function this GO :0019060 and intracellular transport of viral protein in host cell and biological process this GO :0019885 and antigen processing and presentation of endogenous peptide antigen via MHC class I and biological process this GO :0023029 and MHC class Ib protein binding and molecular function this GO :0030176 and integral component of endoplasmic reticulum membrane and cellular component this GO :0042288 and MHC class I protein binding and molecular function this GO :0042590 and antigen processing and presentation of exogenous peptide antigen via MHC class I and biological process this GO :0042605 and peptide antigen binding and molecular function this GO :0042626 and ATPase activity, TAP1 and IDBG-628856 and ENSBTAG00000008953 and 524959, TAP1 and IDBG-81568 and ENSG00000168394 and 6890, Tap1 and IDBG-170616 and ENSMUSG00000037321 and 21354, coupled to transmembrane movement of substances, coupled to transmembrane movement of substances and also this GO :0042803 : protein homodimerization activity and also this GO :0043531 : ADP binding and also this GO :0046978 : TAP1 binding and also this GO :0046979 : TAP2 binding, coupled to transmembrane movement of substances and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0042825 and TAP complex and cellular component this GO :0043531 and ADP binding and molecular function this GO :0046967 and cytosol to ER transport and biological process this GO :0046978 and TAP1 binding and molecular function this GO :0046979 and TAP2 binding and molecular function this GO :0055085 and transmembrane transport and biological process, sub-family B (MDR/TAP), this GO :0002474 and antigen processing and presentation of peptide antigen via MHC class I and biological process this GO :0002479 and antigen processing and presentation of exogenous peptide antigen via MHC class I, this GO :0005215 : transporter activity, this GO :0005215 : transporter activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0015197 : peptide transporter activity and also this GO :0016887 : ATPase activity and also this GO :0023029 : MHC class Ib protein binding and also this GO :0042288 : MHC class I protein binding and also this GO :0042605 : peptide antigen binding and also this GO :0042626 : ATPase activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0015197 : peptide transporter activity, this GO :0016887 : ATPase activity, this GO :0023029 : MHC class Ib protein binding, this GO :0042288 : MHC class I protein binding, this GO :0042605 : peptide antigen binding, this GO :0042626 : ATPase activity, this GO :0042803 : protein homodimerization activity, this GO :0043531 : ADP binding, this GO :0046978 : TAP1 binding, this GO :0046979 : TAP2 binding, transporter 1
Identity: 43
Gene: TAP1 | More about : TAP1
Long gene name: ATP binding cassette subfamily B member , transporter 1
Synonyms gene: ABCB2
Synonyms gene name: ATP-binding cassette, sub-family B (MDR/TAP) , transporter 1
Synonyms: PSF1 RING4 D6S114E
Locus: 6p21, 32
Discovery year: 1992-06-25
Entrez gene record: 6890
Pubmed identfication: 1529427 1946428
RefSeq identity: NM_000593
Classification: ATP binding cassette subfamily B
Havana BLAST/BLAT: OTTHUMG00000031067
Locus Specific Databases: TAP1base: Mutation registry for TAP1 deficiency IMGT/HLA Database LRG_166

Related Products :

AM20194AF-N anti-ABCB2 / APT1 / TAP1 (507-748) Antibody 0,1 mg 500 € acr human
AM20194FC-N anti-ABCB2 / APT1 / TAP1 (507-748) Antibody 50 Вµg 543 € acr human
R1028 anti-ABCB2 / APT1 / TAP1 Antibody 0,1 mg 703 € acr human
AP05638PU-N anti-ABCB2 / APT1 / TAP1 (C-term) Antibody 50 Вµg 485 € acr human
AP13226PU-N anti-ABCB2 / APT1 / TAP1 (C-term) Antibody 0,4 ml 587 € acr human
MBS247403 Anti-Human ABCB2 / TAP1 Antibody 0.05 ml 597 € MBS Polyclonals_1 human
MBS221531 Anti-HUMAN TAP1 (C-TERMINAL) Antibody 50ug 464 € MBS Polyclonals_1 human
GENTAUR-58be506b20825 Anti- TAP1 Antibody 100ug 387 € MBS Polyclonals human
GENTAUR-58be506b79450 Anti- TAP1 Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be506bd6e25 Anti- TAP1 Antibody 0.2 mg 558 € MBS Polyclonals human
MBS422714 Goat anti-TAP1 Antibody 100ug 370 € MBS Polyclonals_1 human
F40131-0.08ML TAP1 Antibody 0.08 ml 199 € NJS poly human
F40131-0.4ML TAP1 Antibody 0.4 ml 406 € NJS poly human
GWB-913563 TAP1 antibody 1 vial 591 € genways human
GWB-9E55C0 TAP1 antibody 1 vial 486 € genways human
GWB-MP549I TAP1 antibody 1 vial 521 € genways human
R32188 TAP1 Antibody 0.1mg 406 € NJS poly human
R35325-100UG TAP1 Antibody 0.1mg 406 € NJS poly human
bs-2789R-A350 Tap1 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2789R-A488 Tap1 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2789R-A555 Tap1 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2789R-A594 Tap1 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2789R-A647 Tap1 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2789R-Biotin Tap1 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-2789R Tap1 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
GWB-71B885 TAP1 antibody (C-terminus) 1 tube 550 € genways human
bs-2789R-Cy3 Tap1 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2789R-Cy5 Tap1 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2789R-Cy5.5 Tap1 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2789R-Cy7 Tap1 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human