| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
RRM2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the RRM2 antibody should be determined by the researcher |
| Intented use: |
This RRM2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P31350 |
| Purity: |
Antigen affinity |
| Description: |
It is mapped to 2p25-p24, Related pseudogenes have been identified on chromosomes 1 and X, Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion, This gene encodes one of two non-identical subunits for ribonucleotide reductase, This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides, Transcription from this gene can initiate from alternative promoters, also known as ribonucleotide reductase small subunit, is an enzyme that in humans is encoded by the RRM2 gene, which results in two isoforms which differ in the lengths of their N-termini, Ribonucleoside-diphosphate reductase subunit M2 |
| Immunogen: |
Amino acids MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT of human RRM2 were used as the immunogen for the RRM2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RRM2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membrane, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
RRM2 |
| Short name: |
RRM2 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
RRM2 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
10452 |
| Gene: |
RRM2 |
More about : RRM2 |
| Long gene name: |
ribonucleotide reductase regulatory subunit M2 |
| Synonyms gene name: |
ribonucleotide reductase M2 polypeptide |
| Locus: |
2p25, 1 |
| Discovery year: |
2001-06-22 |
| Entrez gene record: |
6241 |
| Havana BLAST/BLAT: |
OTTHUMG00000090449 |