RRM2 Antibody

Contact us
Catalog number: R32063
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: RRM2 Antibody
Quantity: 0.1ml
Other quantities: 0.1ml 263€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: RRM2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the RRM2 antibody should be determined by the researcher
Intented use: This RRM2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P31350
Purity: Antigen affinity
Description: It is mapped to 2p25-p24, Related pseudogenes have been identified on chromosomes 1 and X, Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion, This gene encodes one of two non-identical subunits for ribonucleotide reductase, This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides, Transcription from this gene can initiate from alternative promoters, also known as ribonucleotide reductase small subunit, is an enzyme that in humans is encoded by the RRM2 gene, which results in two isoforms which differ in the lengths of their N-termini, Ribonucleoside-diphosphate reductase subunit M2
Immunogen: Amino acids MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT of human RRM2 were used as the immunogen for the RRM2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RRM2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: membrane, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: RRM2
Short name: RRM2 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: RRM2 (Antibody to)
Alternative technique: antibodies
Identity: 10452
Gene: RRM2 | More about : RRM2
Long gene name: ribonucleotide reductase regulatory subunit M2
Synonyms gene name: ribonucleotide reductase M2 polypeptide
Locus: 2p25, 1
Discovery year: 2001-06-22
Entrez gene record: 6241
Havana BLAST/BLAT: OTTHUMG00000090449

Related Products :

GENTAUR-58be12842a3e7 Anti- RRM2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be128482b67 Anti- RRM2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be458a721e1 Anti- RRM2 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be56c93382d Anti- RRM2 Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be56c98b932 Anti- RRM2 Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be56ca03db1 Anti- RRM2 Antibody 100ug 387 € MBS Polyclonals human
XW-7968 anti-RRM2 Antibody 0.05 mg 180 € proscience human
abx141718 Anti-RRM2 Antibody 200 μl 499 € abbex human
abx218099 Anti-RRM2 Antibody inquire 50 € abbex human
AR09519PU-L anti-RRM2 / RR2 (1-389, His-tag) Antibody 0,5 mg 1022 € acr human
AR09519PU-N anti-RRM2 / RR2 (1-389, His-tag) Antibody 0,1 mg 413 € acr human
AM20936PU-N anti-RRM2 / RR2 Antibody 50 Вµg 819 € acr human
AP17721PU-N anti-RRM2 / RR2 (Center) Antibody 0,4 ml 587 € acr human
GENTAUR-58bde694972d0 Mouse Monoclonal [clone 1E1] (IgG1,k) to Human RRM2 Antibody 50ug 663 € MBS mono human
MBS616477 Ribonucleotide Reductase M2 Polypeptide (RRM2) Antibody 50ug 625 € MBS Polyclonals_1 human
GWB-MQ287H RRM2 antibody 1 vial 521 € genways human
R32063 RRM2 Antibody 0.1mg 406 € NJS poly human
bs-7133R-A350 RRM2 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-7133R-A488 RRM2 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-7133R-A555 RRM2 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-7133R-A594 RRM2 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-7133R-A647 RRM2 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-7133R-Biotin RRM2 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-7133R RRM2 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-7133R-Cy3 RRM2 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-7133R-Cy5 RRM2 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-7133R-Cy5.5 RRM2 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-7133R-Cy7 RRM2 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-7133R-FITC RRM2 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-7133R-HRP RRM2 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human