| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
GRP78 / BiP |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the GRP78 antibody should be determined by the researcher |
| Intented use: |
This GRP78 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P11021 |
| Purity: |
Antigen affinity |
| Description: |
(2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi, (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER, 78kD (GRP78) or BiP, BiP is also an essential component of the translocation machinery, Shen et al, The HSPA5 gene is mapped on 9q33, The findings of Shen et al, also known as glucose-regulated protein, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum, 3, HSPA5 (heat shock 70kDa protein 5) |
| Immunogen: |
Amino acids ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE of human GRP78/BiP were used as the immunogen for the GRP78 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GRP78 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membrane, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
GRP78 / BiP |
| Short name: |
GRP78 Antibody / BiP |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
GRP78 (Antibody to) / BiP |
| Alternative technique: |
antibodies |
| Identity: |
5238 |
| Gene: |
HSPA5 |
More about : HSPA5 |
| Long gene name: |
heat shock protein family A (Hsp70) member 5 |
| Synonyms gene: |
GRP78 |
| Synonyms gene name: |
78kD) heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa) , heat shock 70kD protein 5 (glucose-regulated protein |
| Synonyms: |
BiP |
| Synonyms name: |
78kDa , glucose-regulated protein |
| Locus: |
9q33, 3 |
| Discovery year: |
1991-07-26 |
| Entrez gene record: |
3309 |
| Classification: |
Heat shock 70kDa proteins |
| Havana BLAST/BLAT: |
OTTHUMG00000020672 |