Villin Antibody

Contact us
Catalog number: R31923
Price: 332 €
Supplier: Bioss Primary Conjugated Antibodies.
Product name: Villin Antibody
Quantity: 100ul
Other quantities: 0.1ml 263€ 1 mililiter Concentrate 779€ 100ul 426€ 15 ml 724€ 3 ml 310€ 5 + Control Slides 304€ 500ul Concentrate 531€ 7 ml 464€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Villin
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the Villin antibody should be determined by the researcher
Intented use: This Villin antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P09327
Purity: Antigen affinity
Description: In vertebrates, It may play a role in cell plasticity through F-actin severing, This gene encodes a member of a family of calcium-regulated actin-binding proteins, This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, Two mRNAs of 2, and bundling of actin filaments, severing, the villin proteins help to support the microfilaments of the microvilli of the brush border, they result from utilization of alternate poly-adenylation signals present in the terminal exon, 5 kb have been observed, 7 kb and 3, Villin is known as VIL1
Immunogen: Amino acids EQLVNKPVEELPEGVDPSRKEEHLSIEDFT of human Villin were used as the immunogen for the Villin antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Villin antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: luminal membrane of GI tract cells, Cytoplasm
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Villin
Short name: Villin Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Villin (Antibody to)
Alternative technique: antibodies
Identity: 30906
Gene: VILL | More about : VILL
Long gene name: villin like
Locus: 3p22, 2
Discovery year: 2004-07-28
Entrez gene record: 50853
Pubmed identfication: 9179494
RefSeq identity: NM_015873
Classification: Gelsolin/villins
Havana BLAST/BLAT: OTTHUMG00000130814

Related Products :

GWB-7EDC3E Villin 1 (VIL1) Mouse antibody to or anti-Human Monoclonal (3F392) antibody 1 tube 648 € genways human
AM00355SU-N anti-Villin-1 Antibody 1 ml 659 € acr human
AM08413PU-N anti-Villin-1 Antibody 50 Вµl 732 € acr human
AP15855PU-M anti-Villin-1 Antibody 0,5 ml 572 € acr human
AP15855PU-N anti-Villin-1 Antibody 1 ml 804 € acr human
AP15855PU-S anti-Villin-1 Antibody 0,1 ml 326 € acr human
abx128846 Anti-Villin 1 Antibody 100 μg 514 € abbex human
abx219321 Anti-Villin 1 Antibody inquire 50 € abbex human
AM31981PU-M anti-Villin-1 (C-term) Antibody 0,5 ml 790 € acr human
AM31981PU-N anti-Villin-1 (C-term) Antibody 1 ml 1109 € acr human
AM31981PU-S anti-Villin-1 (C-term) Antibody 0,1 ml 471 € acr human
AP17828PU-N anti-Villin-1 (N-term) Antibody 0,4 ml 587 € acr human
MBS420129 Goat anti-Ezrin / villin 2 Antibody 100ug 370 € MBS Polyclonals_1 human
GENTAUR-58bde5ec546bb Mouse Monoclonal (IgG1) to Human VIL1 / Villin Antibody 0.05 ml 597 € MBS mono human
BMDV10314 Villin, 92.5kD, Clone: CWWB1, Mouse Monoclonal antibody-Human; paraffin, IH 500ul 808 € accurate-monoclonals human
GENTAUR-58be1bfc219e1 Villin Antibody 5 + Control Slides 304 € MBS mono human
GENTAUR-58be1bfc7cba3 Villin Antibody 1 mililiter Concentrate 779 € MBS mono human
GENTAUR-58be1bfce7adb Villin Antibody 500ul Concentrate 531 € MBS mono human
GENTAUR-58be1bfd4dd9e Villin Antibody 7 ml 464 € MBS mono human
GENTAUR-58be1bfdb5fab Villin Antibody 3 ml 310 € MBS mono human
GENTAUR-58be1bfe1695c Villin Antibody 15 ml 724 € MBS mono human
GWB-6068FD Villin, antibody 1 tube 637 € genways human
GWB-D78E64 Villin, antibody 1 vial 417 € genways human
MBS274420 Villin antibody 100ul 426 € MBS Polyclonals_1 human
MBS275855 Villin antibody 100ul 426 € MBS Polyclonals_1 human
R31923 Villin Antibody 0.1mg 406 € NJS poly human
bs-3810R-A350 Villin Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3810R-A488 Villin Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3810R-A555 Villin Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3810R-A594 Villin Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human