| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Villin |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the Villin antibody should be determined by the researcher |
| Intented use: |
This Villin antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P09327 |
| Purity: |
Antigen affinity |
| Description: |
In vertebrates, It may play a role in cell plasticity through F-actin severing, This gene encodes a member of a family of calcium-regulated actin-binding proteins, This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, Two mRNAs of 2, and bundling of actin filaments, severing, the villin proteins help to support the microfilaments of the microvilli of the brush border, they result from utilization of alternate poly-adenylation signals present in the terminal exon, 5 kb have been observed, 7 kb and 3, Villin is known as VIL1 |
| Immunogen: |
Amino acids EQLVNKPVEELPEGVDPSRKEEHLSIEDFT of human Villin were used as the immunogen for the Villin antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Villin antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
luminal membrane of GI tract cells, Cytoplasm |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Villin |
| Short name: |
Villin Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Villin (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
30906 |
| Gene: |
VILL |
More about : VILL |
| Long gene name: |
villin like |
| Locus: |
3p22, 2 |
| Discovery year: |
2004-07-28 |
| Entrez gene record: |
50853 |
| Pubmed identfication: |
9179494 |
| RefSeq identity: |
NM_015873 |
| Classification: |
Gelsolin/villins |
| Havana BLAST/BLAT: |
OTTHUMG00000130814 |