Chk2 Antibody / CHEK2

Contact us
Catalog number: R31854
Price: 311 €
Supplier: abbex
Product name: Chk2 Antibody / CHEK2
Quantity: 100 μg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Chk2 / CHEK2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the Chk2 antibody should be determined by the researcher
Intented use: This Chk2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O96017
Purity: Antigen affinity
Description: CDC25B and CDC25C, Following activation, May also negatively regulate cell cycle progression during unperturbed cell cycles, Regulates cell cycle checkpoint arrest through phosphorylation of CDC25A, [UniProt], activation of DNA repair and apoptosis in response to the presence of DNA double-strand breaks, inhibiting their activity, phosphorylates numerous effectors preferentially at the consensus sequence [L-X-R-X-X-S/T], Chk2 is a serine/threonine-protein kinase which is required for checkpoint-mediated cell cycle arrest
Immunogen: Amino acids KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL of human Chk2/CHEK2 were used as the immunogen for the Chk2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Chk2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Chk2 / CHEK2
Short name: Chk2 Antibody / CHEK2
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Chk2 (Antibody to) / checkpoint kinase 2
Alternative technique: antibodies
Alternative to gene target: CDS1 and CHK2 and hCds1 and HuCds1 and LFS2 and PP1425 and RAD53, CHEK2 and IDBG-3314 and ENSG00000183765 and 11200, CHEK2 and IDBG-636030 and ENSBTAG00000004956 and 518897, Chek2 and IDBG-190635 and ENSMUSG00000029521 and 50883, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0006915 and apoptotic process and biological process this GO :0006974 and cellular response to DNA damage stimulus and biological process this GO :0006975 and DNA damage induced protein phosphorylation and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0010332 and response to gamma radiation and biological process this GO :0016301 and kinase activity and molecular function this GO :0016605 and PML body and cellular component this GO :0016772 and transferase activity, DNA-templated and biological process this GO :0046777 and protein autophosphorylation and biological process this GO :0046872 and metal ion binding and molecular function this GO :0050821 and protein stabilization and biological process this GO :0072428 and signal transduction involved in intra-S DNA damage checkpoint and biological process this GO :0090307 and spindle assembly involved in mitosis and biological process this GO :0090399 and replicative senescence and biological process, nuclei, telomeric region and cellular component this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005654 and nucleoplasm and cellular component this GO :0006302 and double-strand break repair and biological process this GO :0006351 and transcription, this GO :0000077 and DNA damage checkpoint and biological process this GO :0000086 and G2/M transition of mitotic cell cycle and biological process this GO :0000781 and chromosome, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004674 : protein serine/threonine kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016301 : kinase activity and also this GO :0016772 : transferase activity, this GO :0004674 : protein serine/threonine kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0016301 : kinase activity, this GO :0016772 : transferase activity, this GO :0019901 : protein kinase binding, this GO :0031625 : ubiquitin protein ligase binding, this GO :0042802 : identical protein binding, this GO :0042803 : protein homodimerization activity, this GO :0046872 : metal ion binding, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0019901 : protein kinase binding and also this GO :0031625 : ubiquitin protein ligase binding and also this GO :0042802 : identical protein binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046872 : metal ion binding, transferring phosphorus-containing groups and molecular function this GO :0019901 and protein kinase binding and molecular function this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0042176 and regulation of protein catabolic process and biological process this GO :0042770 and signal transduction in response to DNA damage and biological process this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0044257 and cellular protein catabolic process and biological process this GO :0045893 and positive regulation of transcription, checkpoint kinase 2
Identity: 16627
Gene: CHEK2 | More about : CHEK2
Long gene name: checkpoint kinase 2
Synonyms gene: RAD53
Synonyms gene name: CHK2 (checkpoint, S, pombe) , pombe) homolog CHK2 checkpoint homolog (S
Synonyms: CDS1 CHK2 HuCds1 PP1425 bA444G7
Locus: 22q12, 1
Discovery year: 2001-09-19
GenBank acession: AF086904
Entrez gene record: 11200
Pubmed identfication: 9836640 10097108
RefSeq identity: NM_001005735
Havana BLAST/BLAT: OTTHUMG00000151023
Locus Specific Databases: LRG_302

Related Products :

MBS619477 Chk2 (Checkpoint Kinase 2, Chek 2, Chek2, Chk 2, CDS 1, CDS1, HuCds 1, HuCds1, LFS2, PP1425, RAD 53, RAD53, Serine/threonine Protein Kinase Chk2) Antibody 100ug 652 € MBS Polyclonals_1 human
GWB-9826BB Serine/Threonine protein Kinase CHK2 (CHEK2) Mouse antibody to or anti-Human Monoclonal (73C175.1.1) antibody 1 vial 602 € genways human
GWB-8B59C9 Serine/Threonine protein Kinase CHK2 (CHEK2) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 vial 602 € genways human
MBS241264 Anti-Human CHEK2 / CHK2 Antibody 50ug 597 € MBS Polyclonals_1 human
R31854 Chk2 Antibody / CHEK2 0.1mg 406 € NJS poly human
GENTAUR-58bde59472ab7 Mouse Monoclonal [clone 73C175.1.1] (IgG1) to Human CHEK2 / CHK2 Antibody 50ug 597 € MBS mono human
MBS243296 PAb (IgG) to Human CHEK2 / CHK2 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS623321 Chk2, phosphorylated (Thr68) (Checkpoint Kinase 2, Chek 2, Chek2, Chk 2, CDS 1, CDS1, HuCds 1, HuCds1, LFS2, PP1425, RAD 53, RAD53, Serine/threonine Protein Kinase Chk2) Antibody 50ug 707 € MBS Polyclonals_1 human
GENTAUR-58b8c857e7ec1 Human Serine/threonine-protein kinase Chk2 (CHEK2) 100ug 2492 € MBS Recombinant Proteins human
GENTAUR-58b8c85866495 Human Serine/threonine-protein kinase Chk2 (CHEK2) 1000ug 2492 € MBS Recombinant Proteins human
GENTAUR-58b8c858bba03 Human Serine/threonine-protein kinase Chk2 (CHEK2) 100ug 3006 € MBS Recombinant Proteins human
GENTAUR-58b8c85933803 Human Serine/threonine-protein kinase Chk2 (CHEK2) 1000ug 3006 € MBS Recombinant Proteins human
GENTAUR-58b9c96dca542 Human Serine/threonine-protein kinase Chk2 (CHEK2) 100ug 2492 € MBS Recombinant Proteins human
GENTAUR-58b9c96e350b1 Human Serine/threonine-protein kinase Chk2 (CHEK2) 1000ug 2492 € MBS Recombinant Proteins human
GENTAUR-58b9c96e887bd Human Serine/threonine-protein kinase Chk2 (CHEK2) 100ug 3006 € MBS Recombinant Proteins human
GENTAUR-58b9c96f07ff4 Human Serine/threonine-protein kinase Chk2 (CHEK2) 1000ug 3006 € MBS Recombinant Proteins human
RP-1634M Recombinant Mouse CHK2 / CHEK2 Protein (His & GST Tag) 20μg 659 € adv mouse
GWB-BBP530 Polyclonal antibody to or anti-CHEK2 antibody 1 vial 463 € genways human
GENTAUR-58bdd761482a6 Anti- Checkpoint Homolog 2 (CHEK2) Antibody 100ug 569 € MBS Polyclonals human
GENTAUR-58bdd798ba47b Anti- Checkpoint Homolog 2 (CHEK2) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd7991c9fa Anti- Checkpoint Homolog 2 (CHEK2) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdd9efed422 Anti- Checkpoint Homolog 2 (CHEK2) Antibody 100ug 608 € MBS Polyclonals human
GENTAUR-58bdf07f7f6e5 Anti- CHEK2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf07fdfa34 Anti- CHEK2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf32963476 Anti- CHEK2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf329bed7a Anti- CHEK2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfae4a14af Anti- CHEK2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfae51f5f3 Anti- CHEK2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be452c91889 Anti- CHEK2 Antibody 100ug 393 € MBS Polyclonals human
abx149174 Anti-CHEK2 Antibody 100 μg 311 € abbex human