| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Chk2 / CHEK2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the Chk2 antibody should be determined by the researcher |
| Intented use: |
This Chk2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O96017 |
| Purity: |
Antigen affinity |
| Description: |
CDC25B and CDC25C, Following activation, May also negatively regulate cell cycle progression during unperturbed cell cycles, Regulates cell cycle checkpoint arrest through phosphorylation of CDC25A, [UniProt], activation of DNA repair and apoptosis in response to the presence of DNA double-strand breaks, inhibiting their activity, phosphorylates numerous effectors preferentially at the consensus sequence [L-X-R-X-X-S/T], Chk2 is a serine/threonine-protein kinase which is required for checkpoint-mediated cell cycle arrest |
| Immunogen: |
Amino acids KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL of human Chk2/CHEK2 were used as the immunogen for the Chk2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Chk2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Chk2 / CHEK2 |
| Short name: |
Chk2 Antibody / CHEK2 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Chk2 (Antibody to) / checkpoint kinase 2 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
CDS1 and CHK2 and hCds1 and HuCds1 and LFS2 and PP1425 and RAD53, CHEK2 and IDBG-3314 and ENSG00000183765 and 11200, CHEK2 and IDBG-636030 and ENSBTAG00000004956 and 518897, Chek2 and IDBG-190635 and ENSMUSG00000029521 and 50883, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0006915 and apoptotic process and biological process this GO :0006974 and cellular response to DNA damage stimulus and biological process this GO :0006975 and DNA damage induced protein phosphorylation and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0010332 and response to gamma radiation and biological process this GO :0016301 and kinase activity and molecular function this GO :0016605 and PML body and cellular component this GO :0016772 and transferase activity, DNA-templated and biological process this GO :0046777 and protein autophosphorylation and biological process this GO :0046872 and metal ion binding and molecular function this GO :0050821 and protein stabilization and biological process this GO :0072428 and signal transduction involved in intra-S DNA damage checkpoint and biological process this GO :0090307 and spindle assembly involved in mitosis and biological process this GO :0090399 and replicative senescence and biological process, nuclei, telomeric region and cellular component this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005654 and nucleoplasm and cellular component this GO :0006302 and double-strand break repair and biological process this GO :0006351 and transcription, this GO :0000077 and DNA damage checkpoint and biological process this GO :0000086 and G2/M transition of mitotic cell cycle and biological process this GO :0000781 and chromosome, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004674 : protein serine/threonine kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016301 : kinase activity and also this GO :0016772 : transferase activity, this GO :0004674 : protein serine/threonine kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0016301 : kinase activity, this GO :0016772 : transferase activity, this GO :0019901 : protein kinase binding, this GO :0031625 : ubiquitin protein ligase binding, this GO :0042802 : identical protein binding, this GO :0042803 : protein homodimerization activity, this GO :0046872 : metal ion binding, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0019901 : protein kinase binding and also this GO :0031625 : ubiquitin protein ligase binding and also this GO :0042802 : identical protein binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046872 : metal ion binding, transferring phosphorus-containing groups and molecular function this GO :0019901 and protein kinase binding and molecular function this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0042176 and regulation of protein catabolic process and biological process this GO :0042770 and signal transduction in response to DNA damage and biological process this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0044257 and cellular protein catabolic process and biological process this GO :0045893 and positive regulation of transcription, checkpoint kinase 2 |
| Identity: |
16627 |
| Gene: |
CHEK2 |
More about : CHEK2 |
| Long gene name: |
checkpoint kinase 2 |
| Synonyms gene: |
RAD53 |
| Synonyms gene name: |
CHK2 (checkpoint, S, pombe) , pombe) homolog CHK2 checkpoint homolog (S |
| Synonyms: |
CDS1 CHK2 HuCds1 PP1425 bA444G7 |
| Locus: |
22q12, 1 |
| Discovery year: |
2001-09-19 |
| GenBank acession: |
AF086904 |
| Entrez gene record: |
11200 |
| Pubmed identfication: |
9836640 10097108 |
| RefSeq identity: |
NM_001005735 |
| Havana BLAST/BLAT: |
OTTHUMG00000151023 |
| Locus Specific Databases: |
LRG_302 |