Recombinant Human Apoptosis Regulator Bcl-2 (C-6His)

Contact us
Catalog number: CR22
Price: 569 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Apoptosis Regulator Bcl-2 (C-6His)
Quantity: 100ug
Other quantities: 1 mg 1674€ 10 µg 146€ 500 µg 1186€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Apoptosis Regulator Bcl-2 is produced by our E, coli expression system and the target gene encoding Met1-Asp211 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 24
UniProt number: P10415
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 10%Glycerol, 150 mM sodium chloride, pH8, 2 um filtered solution of 20 mM HEPES, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Regulator Bcl-2 (C-6His)
Short name: Recombinant Apoptosis Regulator Bcl-2 (C-6His)
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens programmed cellular destruction Regulator Bcl-2 (C-6His), recombinant H
Alternative technique: rec

Related Products :

MBS616948 Prostate Apoptosis Response Protein 4 (Par4 Induced by Effectors of Apoptosis, PAWR, PRKC Apoptosis WT1 Regulator Protein, Prostate Apoptosis Response 4 Protein, Prostate Apoptosis Response Protein PAR-4, Transcriptional Repressor PAR4, WT1 Interacting Pr 100ul 575 € MBS Polyclonals_1 human
MBS624587 Bad, BH3 Domain (Bcl2 Antagonist Of Cell Death, BAD, Bcl-2-binding Component 6, Bcl-XL/Bcl-2-Associated Death Promoter, Bcl-2-like 8 Protein, BAD, BBC6, BCL2L8) Antibody 200ul 597 € MBS Polyclonals_1 human
CR22 Recombinant Human Apoptosis Regulator Bcl-2 (C-6His) 500 µg 1186 € novo human
MBS623426 Bak, BH3 Domain (Bcl-2 Homologous Antagonist/Killer, Apoptosis Regulator BAK, Bcl-2-like Protein 7, Bcl2-L-7, BAK1, BCL2L7, CDN1) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS619110 XIAP (X Linked Inhibitor of Apoptosis, X-linked Inhibitor of Apoptosis Protein, X-linked IAP, Apoptosis Inhibitor 3, API3, Baculoviral IAP Repeat Containing 4, Baculoviral IAP Repeat-containing Protein 4, BIRC4, HILP, IAP 3, IAP3, IAP-like Protein, ILP-1, 50ug 641 € MBS Polyclonals_1 human
MBS610635 PUMA (p53 Upregulated Modulator of Apoptosis, BCL2 Binding Component 3, BCL-2 Binding Component 3, BBC3, JFY1, JFY-1, p53 Up-regulated Modulator of Apoptosis, PUMA alpha, PUMA/JFY1) 100ug 558 € MBS Polyclonals_1 human
MBS621291 Bcl 2-Related Protein A1 (Bcl 2 Related Protein A1, Bcl-2-related Protein A1, ACC-1, ACC-2, BCL2L5, BFL1, BFL-1, GRS, Hematopoietic Bcl2-related Protein A1, HBPA1, Hemopoietic-specific Early Response Protein, Protein BFL-1, Protein GRS) Antibody 50ug 724 € MBS Polyclonals_1 human
GWB-47C732 Apoptosis Regulator Bcl-2 (BCL2) Rabbit antibody to or anti-Human Polyclonal (Ser70) antibody 1 x 1 vial 602 € genways human
GWB-E2C8B2 Apoptosis Regulator Bcl-2 (BCL2) Rabbit antibody to or anti-Human Polyclonal (Thr56) antibody 1 vial 602 € genways human
GWB-934FB6 Apoptosis Regulator BCL-G (BCLG) (BCL2L14) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 602 € genways human
abx254808 Anti-Mouse Apoptosis regulator Bcl-2 ELISA Kit inquire 50 € abbex mouse
GENTAUR-58bd581529c26 mouse Apoptosis regulator Bcl-2 protein 0.2 mg 564 € MBS Recombinant Proteins human
GENTAUR-58bd58157caa6 mouse Apoptosis regulator Bcl-2 protein 1000ug 1475 € MBS Recombinant Proteins human
GENTAUR-58bd5815c8918 mouse Apoptosis regulator Bcl-2 protein 0.5 mg 951 € MBS Recombinant Proteins human
GENTAUR-58bd581623b25 mouse Apoptosis regulator Bcl-2 protein 0.05 mg 265 € MBS Recombinant Proteins human
MBS619182 BAG1 (BAG Family Molecular Chaperone Regulator 1, BAG-1, BCL-2 Associated Athanogene 1, BCL-2-associated Athanogene 1, BCL2-associated Athanogene, RAP46) Antibody 100ug 636 € MBS Polyclonals_1 human
C272 Recombinant Human Apoptosis-Inducing Factor 1 Mitochondrial, AIFM1 (N-6His) 500 µg 1613 € novo human
CF02 Recombinant Human BAX, Bcl-2-Like Protein 4, BCL2L4 (N, C-6His) 1 mg 2486 € novo human
CE40 Recombinant Human Bcl-2-Associated Athanogene 1, BAG2 (N-6His) 1 mg 2283 € novo human
C104 Recombinant Human Bcl-2-Like Protein 1, BCL2L1 (C-6His) 50 µg 369 € novo human
CR24 Recombinant Human Bcl-2-like Protein 11, BIML (N-6His) 10 µg 202 € novo human
C105 Recombinant Human Bcl-2-Llike Protein 2, BCL2L2 (C-6His) 500 µg 1613 € novo human
C103 Recombinant Human Bcl-2 Related Protein A1, BCL2A1 (C-6His) 1 mg 2283 € novo human
MBS616038 PLEKHG5 (Pleckstrin Homology Domain Containing Family G (with RhoGef domain) Member 5, APO3, Apo-3, Apoptosis-inducing Receptor AIR, Apoptosis-mediating Receptor DR3, Apoptosis-mediating Receptor TRAMP, Death Domain Receptor 3, DDR3, DR3, DSMA4, Guanine N Antibody 200ul 735 € MBS Polyclonals_1 human
GENTAUR-58bdb596ac034 Human Apoptosis facilitator Bcl-2-like protein 14 (BCL2L14) 100ug 1940 € MBS Recombinant Proteins human
GENTAUR-58bdb59718066 Human Apoptosis facilitator Bcl-2-like protein 14 (BCL2L14) 1000ug 1940 € MBS Recombinant Proteins human
GENTAUR-58bdb59785d81 Human Apoptosis facilitator Bcl-2-like protein 14 (BCL2L14) 100ug 2453 € MBS Recombinant Proteins human
GENTAUR-58bdb597dbf0d Human Apoptosis facilitator Bcl-2-like protein 14 (BCL2L14) 1000ug 2453 € MBS Recombinant Proteins human
MBS616224 p53 Upregulated Modulator of Apoptosis alpha, (Bcl 2 Binding Component 3, PUMA, bbc3) Antibody 100ug 591 € MBS Polyclonals_1 human
MBS618698 p53 Upregulated Modulator of Apoptosis/Bcl 2 Binding Component 3, CT (PUMA/bbc3) 100ug 569 € MBS Polyclonals_1 human