Recombinant Mouse TNF ligand superfamily member 9, TNFSF9(N-10His)

Contact us
Catalog number: CS34
Price: 1625 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Mouse TNF ligand superfamily member 9, TNFSF9(N-10His)
Quantity: 1000ug
Other quantities: 1 mg 1877€ 500 µg 1328€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse 4-1BB Ligand is produced by our Mammalian expression system and the target gene encoding Arg104-Glu309 is expressed with a 10His tag at the N-terminus
Molecular Weight: 25, 6 kD
UniProt number: P41274
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HHHHHHHHHHGGGSGGGSGGGSIEGRRTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene: TNFSF9 | More about : TNFSF9
Gene target: TNFSF9(N-10His), TNF ligand superfamily member 9
Short name: TNFSF9(N-10His), Recombinant Mouse TNF ligand superfamily member 9
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: member 9(N-10His), tumor necrosis factor (ligand) superfamily, recombinant Mouse tumor necrosis factor ligand supergroup member 9
Alternative technique: rec
Alternative to gene target: 4-1BB-L and CD137L, DIF and TNF-alpha and TNFA and TNFSF2, DNA-templated and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0045994 and positive regulation of translational initiation by iron and biological process this GO :0046325 and negative regulation of glucose import and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0048566 and embryonic digestive tract development and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0050708 and regulation of protein secretion and biological process this GO :0050715 and positive regulation of cytokine secretion and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0050796 and regulation of insulin secretion and biological process this GO :0050806 and positive regulation of synaptic transmission and biological process this GO :0050830 and defense response to Gram-positive bacterium and biological process this GO :0050900 and leukocyte migration and biological process this GO :0050901 and leukocyte tethering or rolling and biological process this GO :0050966 and detection of mechanical stimulus involved in sensory perception of pain and biological process this GO :0050995 and negative regulation of lipid catabolic process and biological process this GO :0051023 and regulation of immunoglobulin secretion and biological process this GO :0051044 and positive regulation of membrane protein ectodomain proteolysis and biological process this GO :0051091 and positive regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0051222 and positive regulation of protein transport and biological process this GO :0051384 and response to glucocorticoid and biological process this GO :0051533 and positive regulation of NFAT protein import into nucleus and biological process this GO :0051798 and positive regulation of hair follicle development and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0055037 and recycling endosome and cellular component this GO :0060557 and positive regulation of vitamin D biosynthetic process and biological process this GO :0060559 and positive regulation of calcidiol 1-monooxygenase activity and biological process this GO :0060664 and epithelial cell proliferation involved in salivary gland morphogenesis and biological process this GO :0060693 and regulation of branching involved in salivary gland morphogenesis and biological process this GO :0061048 and negative regulation of branching involved in lung morphogenesis and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071230 and cellular response to amino acid stimulus and biological process this GO :0071316 and cellular response to nicotine and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071677 and positive regulation of mononuclear cell migration and biological process this GO :0071803 and positive regulation of podosome assembly and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :0097527 and necroptotic signaling pathway and biological process this GO :1990268 and response to this GO ld nanoparticle and biological process this GO :2000010 and positive regulation of protein localization to cell surface and biological process this GO :2000343 and positive regulation of chemokine (C-X-C motif) ligand 2 production and biological process this GO :2000377 and regulation of reactive oxygen species metabolic process and biological process this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, Extracellular, Extracellular, TNF and IDBG-300259 and ENSG00000232810 and 7124, TNF and IDBG-634161 and ENSBTAG00000025471 and 280943, TNFSF9 and IDBG-21688 and ENSG00000125657 and 8744, TNFSF9 and IDBG-643947 and ENSBTAG00000046266 and 521748, Tnf and IDBG-177358 and ENSMUSG00000024401 and 21926, Tnfsf9 and IDBG-193693 and ENSMUSG00000035678 and 21950, member 9, this GO :0000060 and protein import into nucleus, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding and also this GO :0044212 : transcription regulatory region DNA binding, this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008283 and cell proliferation and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0032729 and positive regulation of interferon-gamma production and biological process this GO :0032735 and positive regulation of interleukin-12 production and biological process this GO :0032755 and positive regulation of interleukin-6 production and biological process this GO :0032813 and tumor necrosis factor receptor superfamily binding and molecular function this GO :0042104 and positive regulation of activated T cell proliferation and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0043011 and myeloid dendritic cell differentiation and biological process this GO :0045087 and innate immune response and biological process this GO :0045585 and positive regulation of cytotoxic T cell differentiation and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding and also this GO :0032813 : tumor necrosis factor receptor superfamily binding, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005515 : protein binding, this GO :0005515 : protein binding, this GO :0032813 : tumor necrosis factor receptor superfamily binding, this GO :0042802 : identical protein binding, this GO :0044212 : transcription regulatory region DNA binding, transcription regulatory region DNA binding, translocation and biological process this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000165 and MAPK cascade and biological process this GO :0000185 and activation of MAPKKK activity and biological process this GO :0000187 and activation of MAPK activity and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001775 and cell activation and biological process this GO :0001819 and positive regulation of cytokine production and biological process this GO :0001891 and pha this GO cytic cup and cellular component this GO :0001932 and regulation of protein phosphorylation and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0002020 and protease binding and molecular function this GO :0002037 and negative regulation of L-glutamate transport and biological process this GO :0002439 and chronic inflammatory response to antigenic stimulus and biological process this GO :0002740 and negative regulation of cytokine secretion involved in immune response and biological process this GO :0002876 and positive regulation of chronic inflammatory response to antigenic stimulus and biological process this GO :0002925 and positive regulation of humoral immune response mediated by circulating immunoglobulin and biological process this GO :0003009 and skeletal muscle contraction and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006006 and glucose metabolic process and biological process this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006927 and transformed cell apoptotic process and biological process this GO :0006952 and defense response and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0006959 and humoral immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007254 and JNK cascade and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0009314 and response to radiation and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0009615 and response to virus and biological process this GO :0009651 and response to salt stress and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0010628 and positive regulation of gene expression and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0010693 and negative regulation of alkaline phosphatase activity and biological process this GO :0010888 and negative regulation of lipid storage and biological process this GO :0014823 and response to activity and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019722 and calcium-mediated signaling and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030316 and osteoclast differentiation and biological process this GO :0030730 and sequestering of triglyceride and biological process this GO :0031334 and positive regulation of protein complex assembly and biological process this GO :0031622 and positive regulation of fever generation and biological process this GO :0031663 and lipopolysaccharide-mediated signaling pathway and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032715 and negative regulation of interleukin-6 production and biological process this GO :0032722 and positive regulation of chemokine production and biological process this GO :0032729 and positive regulation of interferon-gamma production and biological process this GO :0032741 and positive regulation of interleukin-18 production and biological process this GO :0032755 and positive regulation of interleukin-6 production and biological process this GO :0032800 and receptor biosynthetic process and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0034116 and positive regulation of heterotypic cell-cell adhesion and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042346 and positive regulation of NF-kappaB import into nucleus and biological process this GO :0042493 and response to drug and biological process this GO :0042742 and defense response to bacterium and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043068 and positive regulation of programmed cell death and biological process this GO :0043122 and regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043242 and negative regulation of protein complex disassembly and biological process this GO :0043243 and positive regulation of protein complex disassembly and biological process this GO :0043280 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043406 and positive regulation of MAP kinase activity and biological process this GO :0043491 and protein kinase B signaling and biological process this GO :0043507 and positive regulation of JUN kinase activity and biological process this GO :0043525 and positive regulation of neuron apoptotic process and biological process this GO :0044130 and negative regulation of growth of symbiont in host and biological process this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0045071 and negative regulation of viral genome replication and biological process this GO :0045080 and positive regulation of chemokine biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0045123 and cellular extravasation and biological process this GO :0045416 and positive regulation of interleukin-8 biosynthetic process and biological process this GO :0045429 and positive regulation of nitric oxide biosynthetic process and biological process this GO :0045599 and negative regulation of fat cell differentiation and biological process this GO :0045668 and negative regulation of osteoblast differentiation and biological process this GO :0045670 and regulation of osteoclast differentiation and biological process this GO :0045672 and positive regulation of osteoclast differentiation and biological process this GO :0045760 and positive regulation of action potential and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0045892 and negative regulation of transcription, tumor necrosis factor, tumor necrosis factor receptor superfamily binding, tumor necrosis factor (ligand) superfamily
Identity: 11939
Long gene name: tumor necrosis factor superfamily member 9
Synonyms gene name: member 9 , tumor necrosis factor (ligand) superfamily
Synonyms: 4-1BB-L
Synonyms name: receptor 4-1BB ligand homolog of mouse 4-1BB-L
Locus: 19p13, 3
Discovery year: 1998-12-04
GenBank acession: U03398
Entrez gene record: 8744
Pubmed identfication: 8405064 8088337
RefSeq identity: NM_003811
Classification: Tumor necrosis factor superfamily
Havana BLAST/BLAT: OTTHUMG00000181831

Related Products :

CS34 Recombinant Mouse TNF ligand superfamily member 9, TNFSF9(N-10His) 1 mg 1877 € novo mouse
MBS612868 APRIL, ED2 (a Proliferation Inducing Ligand, TALL-2, TNF and ApoL-related Leukocyte-expressed Ligand 2, TRDL-1a, TNF-related Death Ligand 1a, TNFSF13) Antibody 100ug 569 € MBS Polyclonals_1 human
abx263483 Anti-TNF Ligand Receptor Superfamily Member 10B Protein (Recombinant) 1 mg 1862 € abbex human
abx260696 Anti-TNF Ligand Receptor Superfamily Member 12A Protein (Recombinant) 25 µg 340 € abbex human
abx262984 Anti-TNF Ligand Superfamily Member 12 Protein (Recombinant) 25 µg 340 € abbex human
GWB-AD8F0E Recombinant Human TNF Ligand Superfamily Member 12 bulk Ask price € genways bulk human
MBS619623 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, TNFR1, TNF-R1, TNF-R, Tumor Necrosis Factor Receptor Type I, TNFR-I, TNF-RI, TNF-R-I, CD120a, FPF, MGC19588, p55, p55-R, p60, TBP1, TNFR55, TNF-R55, TNFR60, Tumor Necrosis Factor alpha Receptor, TNFAR, Tu Antibody 100ug 652 € MBS Polyclonals_1 human
GWB-E4CAE1 TNF Ligand Superfamily, Member 10 (TNFSF10) Rabbit antibody to or anti-Human Polyclonal antibody 1 vial 602 € genways human
GWB-DC9C26 TNF Ligand Superfamily, Member 11 (TNFSF11) Rabbit antibody to or anti-Human Polyclonal (Internal) antibody 1 vial 602 € genways human
GWB-4DD9B5 TNF Ligand Superfamily, Member 13 (TNFSF13/APRIL) Rabbit antibody to or anti-Human Polyclonal (aa1-17) antibody 1 x 1 vial 602 € genways human
GWB-D3C992 TNF Ligand Superfamily, Member 15 (TL1A/TNFSF15) Rabbit antibody to or anti-Human Polyclonal antibody 1 vial 602 € genways human
GWB-6352D0 TNF Ligand Superfamily, Member 15 (TL1A/TNFSF15) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 tube 602 € genways human
GWB-A6B46A TNF Ligand Superfamily, Member 6 (FASLG) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 vial 648 € genways human
TNFR25-R-20 Recombinant purified human TNF Receptor 2 (TNFR2/TNF-RII, Etannercept/TNF-R75, p75TNFR) protein (E.Coli, His-tag) 10 μg 333 € adi human
CK44 Recombinant Human TNF Receptor Superfamily Member 11B, OPG (C-Fc) 50 µg 496 € novo human
abx167342 Anti-Tumor Necrosis Factor Ligand Superfamily, Member 12 Protein (Recombinant) 10 μg 412 € abbex human
abx166323 Anti-Tumor Necrosis Factor Ligand Superfamily, Member 13 Protein (Recombinant) 100 μg 949 € abbex human
abx167016 Anti-Tumor Necrosis Factor Ligand Superfamily, Member 9 Protein (Recombinant) 100 μg 862 € abbex human
abx167438 Anti-Tumor Necrosis Factor Ligand Superfamily, Member 9 Protein (Recombinant) 100 μg 891 € abbex human
CP25 Recombinant Mouse α-2-HS-Glycoprotein, , AHSG, Fetuin A (C-10His) 500 µg 1009 € novo human
CS72 Recombinant Mouse Alpha-Fetoprotein, AFP (C-10His) 1 mg 2283 € novo mouse
CP03 Recombinant Mouse Complement Factor D, Adipsin (C-10His) 10 µg 202 € novo mouse
CS87 Recombinant Mouse Myeloperoxidase, MPO (C-10His) 10 µg 156 € novo mouse
CS85 Recombinant Mouse Renin (C-10His) 500 µg 1328 € novo mouse
GENTAUR-58ba572664c87 Mouse Tumor necrosis factor ligand superfamily member 11 (Tnfsf11) 100ug 1735 € MBS Recombinant Proteins mouse
GENTAUR-58ba5726d6612 Mouse Tumor necrosis factor ligand superfamily member 11 (Tnfsf11) 1000ug 1735 € MBS Recombinant Proteins mouse
GENTAUR-58ba5727726b4 Mouse Tumor necrosis factor ligand superfamily member 11 (Tnfsf11) 100ug 2249 € MBS Recombinant Proteins mouse
GENTAUR-58ba57280fd98 Mouse Tumor necrosis factor ligand superfamily member 11 (Tnfsf11) 1000ug 2249 € MBS Recombinant Proteins mouse
GENTAUR-58bca7947030d Mouse Tumor necrosis factor ligand superfamily member 12 (Tnfsf12) 100ug 1625 € MBS Recombinant Proteins mouse
GENTAUR-58bca794ba154 Mouse Tumor necrosis factor ligand superfamily member 12 (Tnfsf12) 1000ug 1625 € MBS Recombinant Proteins mouse