| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Osteoprotegerin is produced by our Mammalian expression system and the target gene encoding Glu22-Leu201 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
2 kD, 47 |
| UniProt number: |
O00300 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLDIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene: |
TNFRSF11B |
More about : TNFRSF11B |
| Gene target: |
OPG (C-Fc), TNF Receptor Superfamily Member 11B |
| Short name: |
OPG (C-Fc), Recombinant TNF Receptor Superfamily Member 11B |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
OPG (C-fragment c), sapiens tumor necrosis factor Receptor supergroup Member 11B, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
DIF and TNF-alpha and TNFA and TNFSF2, DNA-templated and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0045994 and positive regulation of translational initiation by iron and biological process this GO :0046325 and negative regulation of glucose import and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0048566 and embryonic digestive tract development and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0050708 and regulation of protein secretion and biological process this GO :0050715 and positive regulation of cytokine secretion and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0050796 and regulation of insulin secretion and biological process this GO :0050806 and positive regulation of synaptic transmission and biological process this GO :0050830 and defense response to Gram-positive bacterium and biological process this GO :0050900 and leukocyte migration and biological process this GO :0050901 and leukocyte tethering or rolling and biological process this GO :0050966 and detection of mechanical stimulus involved in sensory perception of pain and biological process this GO :0050995 and negative regulation of lipid catabolic process and biological process this GO :0051023 and regulation of immunoglobulin secretion and biological process this GO :0051044 and positive regulation of membrane protein ectodomain proteolysis and biological process this GO :0051091 and positive regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0051222 and positive regulation of protein transport and biological process this GO :0051384 and response to glucocorticoid and biological process this GO :0051533 and positive regulation of NFAT protein import into nucleus and biological process this GO :0051798 and positive regulation of hair follicle development and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0055037 and recycling endosome and cellular component this GO :0060557 and positive regulation of vitamin D biosynthetic process and biological process this GO :0060559 and positive regulation of calcidiol 1-monooxygenase activity and biological process this GO :0060664 and epithelial cell proliferation involved in salivary gland morphogenesis and biological process this GO :0060693 and regulation of branching involved in salivary gland morphogenesis and biological process this GO :0061048 and negative regulation of branching involved in lung morphogenesis and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071230 and cellular response to amino acid stimulus and biological process this GO :0071316 and cellular response to nicotine and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071677 and positive regulation of mononuclear cell migration and biological process this GO :0071803 and positive regulation of podosome assembly and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :0097527 and necroptotic signaling pathway and biological process this GO :1990268 and response to this GO ld nanoparticle and biological process this GO :2000010 and positive regulation of protein localization to cell surface and biological process this GO :2000343 and positive regulation of chemokine (C-X-C motif) ligand 2 production and biological process this GO :2000377 and regulation of reactive oxygen species metabolic process and biological process this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, Extracellular, TNF and IDBG-300259 and ENSG00000232810 and 7124, TNF and IDBG-634161 and ENSBTAG00000025471 and 280943, Tnf and IDBG-177358 and ENSMUSG00000024401 and 21926, this GO :0000060 and protein import into nucleus, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding and also this GO :0044212 : transcription regulatory region DNA binding, this GO :0005125 : cytokine activity, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005515 : protein binding, this GO :0042802 : identical protein binding, this GO :0044212 : transcription regulatory region DNA binding, transcription regulatory region DNA binding, translocation and biological process this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000165 and MAPK cascade and biological process this GO :0000185 and activation of MAPKKK activity and biological process this GO :0000187 and activation of MAPK activity and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001775 and cell activation and biological process this GO :0001819 and positive regulation of cytokine production and biological process this GO :0001891 and pha this GO cytic cup and cellular component this GO :0001932 and regulation of protein phosphorylation and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0002020 and protease binding and molecular function this GO :0002037 and negative regulation of L-glutamate transport and biological process this GO :0002439 and chronic inflammatory response to antigenic stimulus and biological process this GO :0002740 and negative regulation of cytokine secretion involved in immune response and biological process this GO :0002876 and positive regulation of chronic inflammatory response to antigenic stimulus and biological process this GO :0002925 and positive regulation of humoral immune response mediated by circulating immunoglobulin and biological process this GO :0003009 and skeletal muscle contraction and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006006 and glucose metabolic process and biological process this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006927 and transformed cell apoptotic process and biological process this GO :0006952 and defense response and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0006959 and humoral immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007254 and JNK cascade and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0009314 and response to radiation and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0009615 and response to virus and biological process this GO :0009651 and response to salt stress and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0010628 and positive regulation of gene expression and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0010693 and negative regulation of alkaline phosphatase activity and biological process this GO :0010888 and negative regulation of lipid storage and biological process this GO :0014823 and response to activity and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019722 and calcium-mediated signaling and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030316 and osteoclast differentiation and biological process this GO :0030730 and sequestering of triglyceride and biological process this GO :0031334 and positive regulation of protein complex assembly and biological process this GO :0031622 and positive regulation of fever generation and biological process this GO :0031663 and lipopolysaccharide-mediated signaling pathway and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032715 and negative regulation of interleukin-6 production and biological process this GO :0032722 and positive regulation of chemokine production and biological process this GO :0032729 and positive regulation of interferon-gamma production and biological process this GO :0032741 and positive regulation of interleukin-18 production and biological process this GO :0032755 and positive regulation of interleukin-6 production and biological process this GO :0032800 and receptor biosynthetic process and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0034116 and positive regulation of heterotypic cell-cell adhesion and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042346 and positive regulation of NF-kappaB import into nucleus and biological process this GO :0042493 and response to drug and biological process this GO :0042742 and defense response to bacterium and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043068 and positive regulation of programmed cell death and biological process this GO :0043122 and regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043242 and negative regulation of protein complex disassembly and biological process this GO :0043243 and positive regulation of protein complex disassembly and biological process this GO :0043280 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043406 and positive regulation of MAP kinase activity and biological process this GO :0043491 and protein kinase B signaling and biological process this GO :0043507 and positive regulation of JUN kinase activity and biological process this GO :0043525 and positive regulation of neuron apoptotic process and biological process this GO :0044130 and negative regulation of growth of symbiont in host and biological process this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0045071 and negative regulation of viral genome replication and biological process this GO :0045080 and positive regulation of chemokine biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0045123 and cellular extravasation and biological process this GO :0045416 and positive regulation of interleukin-8 biosynthetic process and biological process this GO :0045429 and positive regulation of nitric oxide biosynthetic process and biological process this GO :0045599 and negative regulation of fat cell differentiation and biological process this GO :0045668 and negative regulation of osteoblast differentiation and biological process this GO :0045670 and regulation of osteoclast differentiation and biological process this GO :0045672 and positive regulation of osteoclast differentiation and biological process this GO :0045760 and positive regulation of action potential and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0045892 and negative regulation of transcription, tumor necrosis factor |
| Identity: |
11909 |
| Long gene name: |
TNF receptor superfamily member 11b |
| Synonyms gene: |
OPG |
| Synonyms gene name: |
member 11b , osteoprotegerin tumor necrosis factor receptor superfamily |
| Synonyms: |
OCIF TR1 |
| Locus: |
8q24, 12 |
| Discovery year: |
1997-09-05 |
| GenBank acession: |
U94332 |
| Entrez gene record: |
4982 |
| Pubmed identfication: |
9108485 |
| Classification: |
Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000164969 |