Recombinant Mouse Platelet Receptor Gi24, VISTA, B7-H5 (C-6His)

Contact us
Catalog number: CS06
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Mouse Platelet Receptor Gi24, VISTA, B7-H5 (C-6His)
Quantity: 0.1ml
Other quantities: 10 µg 146€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Platelet receptor Gi24 is produced by our Mammalian expression system and the target gene encoding Phe33-Ala191 is expressed fused with a 6His tag at the C-terminus
Molecular Weight: 18, 6 kD
UniProt number: Q9D659
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: B7-H5 (C-6His), VISTA, Platelet Receptor Gi24
Short name: B7-H5 (C-6His), VISTA, Recombinant Mouse Platelet Receptor Gi24
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: B7-H5 (C-6His), VISTA, recombinant Mouse Platelet Receptor Gi24
Alternative technique: rec
Identity: 4905
Gene: HHLA2 | More about : HHLA2
Long gene name: HERV-H LTR-associating 2
Synonyms: B7H7 B7-H5 B7y
Locus: 3q13, 13
Discovery year: 1999-09-07
GenBank acession: AF126162
Entrez gene record: 11148
Pubmed identfication: 10444326 23784006 22488247
RefSeq identity: NM_007072
Classification: C1-set domain containing V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000159224

Related Products :

CS06 Recombinant Mouse Platelet Receptor Gi24, VISTA, B7-H5 (C-6His) 10 µg 146 € novo mouse
C791 Recombinant Human Platelet Receptor Gi24, VISTA, B7-H5, PD-1H (C-Fc) 1 mg 1115 € novo human
RP-1096RC Recombinant Cynomolgus B7-H5 / GI24 / VISTA Protein (His Tag) 50μg 659 € adv human
RP-0114H Recombinant Human B7-H5 / Gi24 / VISTA Protein (His Tag) 50μg 624 € adv human
AR51984PU-N anti-Platelet receptor Gi24 (33-191, His-tag) Antibody 0,25 mg 1413 € acr human
AR51984PU-S anti-Platelet receptor Gi24 (33-191, His-tag) Antibody 50 Вµg 485 € acr human
AR52010PU-N anti-Platelet receptor Gi24 (33-194, His-tag) Antibody 0,25 mg 1413 € acr human
AR52010PU-S anti-Platelet receptor Gi24 (33-194, His-tag) Antibody 50 Вµg 485 € acr human
AE59251HU-48 ELISA test for Human Platelet receptor Gi24 (C10orf54) 1x plate of 48 wells 373 € abebio human
AE59251HU-96 Human Platelet receptor Gi24 (C10orf54) ELISA Kit 1x plate of 96 wells 612 € abebio human
MBS623858 Integrin, beta3, CT (ITGB3, CD61, GP3A, GPIIIa, HPA-1, NAIT, Platelet Fibrinogen Receptor beta Subunit, Platelet Glycoprotein IIIa, Platelet Membrane Glycoprotein IIIa) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS621028 Integrin, beta3 (ITGB3, CD61, GP3A, GPIIIa, HPA-1, NAIT, Platelet Fibrinogen Receptor beta Subunit, Platelet Glycoprotein IIIa, Platelet Membrane Glycoprotein IIIa) Antibody 50ug 928 € MBS Polyclonals_1 human
MBS624603 Integrin, beta3, phosphorylated (Tyr773) (Platelet Glycoprotein IIIa, CD61, GP3A, GPIIIa, ITGB3, NAIT, Platelet Fibrinogen Receptor beta Subunit, Platelet Membrane Glycoprotein IIIa) Antibody 50ug 481 € MBS Polyclonals_1 human
C658 Recombinant Human Platelet-derived Growth Factor Receptor Alpha, PDGF Rα (C-6His) 50 µg 278 € novo human
C380 Recombinant Human Platelet-Derived Growth Factor Receptor β, PDGFR-β (C-6His) 1 mg 1674 € novo human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
CH46 Recombinant Human Platelet-Derived Growth Factor AA, PDGF-AA (N-6His) 1 mg 2486 € novo human
CS74 Recombinant Human Platelet Endothelial Cell Adhesion Molecule, PECAM-1, CD31 (C-6His) 50 µg 202 € novo human
GENTAUR-58be67d8116b6 Anti-GI24 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
bs-9898R-A350 GI24 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9898R-A488 GI24 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9898R-A555 GI24 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9898R-A594 GI24 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9898R-A647 GI24 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9898R-Biotin GI24 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-9898R GI24 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-9898R-Cy3 GI24 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-9898R-Cy5 GI24 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-9898R-Cy5.5 GI24 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-9898R-Cy7 GI24 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human