| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Prolactin receptor is produced by our Mammalian expression system and the target gene encoding Gln20-Asp229 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
25, 6 kD |
| UniProt number: |
Q08501 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKDVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
PRLR (C-6His), Prolactin Receptor |
| Short name: |
PRLR (C-6His), Recombinant Mouse Prolactin Receptor |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
prolactin receptor (C-6His), recombinant Mouse Prolactin Receptor |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, HPRL and hPRLrI and MFAB, PRLR and IDBG-15793 and ENSG00000113494 and 5618, PRLR and IDBG-630451 and ENSBTAG00000025035 and 281422, Prlr and IDBG-129218 and ENSMUSG00000005268 and 19116, metal ion binding, this GO :0004896 and cytokine receptor activity and molecular function this GO :0004925 and prolactin receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006694 and steroid biosynthetic process and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007171 and activation of transmembrane receptor protein tyrosine kinase activity and biological process this GO :0007259 and JAK-STAT cascade and biological process this GO :0007566 and embryo implantation and biological process this GO :0007595 and lactation and biological process this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0017046 and peptide hormone binding and molecular function this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030155 and regulation of cell adhesion and biological process this GO :0030856 and regulation of epithelial cell differentiation and biological process this GO :0031904 and endosome lumen and cellular component this GO :0038161 and prolactin signaling pathway and biological process this GO :0042110 and T cell activation and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0042977 and activation of JAK2 kinase activity and biological process this GO :0042978 and ornithine decarboxylase activator activity and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0046872 and metal ion binding and molecular function this GO :0060397 and JAK-STAT cascade involved in growth hormone signaling pathway and biological process this GO :0060644 and mammary gland epithelial cell differentiation and biological process this GO :0060736 and prostate gland growth and biological process this GO :0060749 and mammary gland alveolus development and biological process this GO :0061180 and mammary gland epithelium development and biological process, this GO :0004896 : cytokine receptor activity, this GO :0004896 : cytokine receptor activity and also this GO :0004925 : prolactin receptor activity and also this GO :0005515 : protein binding and also this GO :0017046 : peptide hormone binding and also this GO :0042803 : protein homodimerization activity and also this GO :0042978 : ornithine decarboxylase activator activity and also this GO :0046872 : metal ion binding, this GO :0004925 : prolactin receptor activity, this GO :0005515 : protein binding, this GO :0017046 : peptide hormone binding, this GO :0042803 : protein homodimerization activity, this GO :0042978 : ornithine decarboxylase activator activity, this GO :0046872 : metal ion binding, prolactin receptor |
| Identity: |
9446 |
| Gene: |
PRLR |
More about : PRLR |
| Long gene name: |
prolactin receptor |
| Locus: |
5p13, 2 |
| Discovery year: |
1989-12-01 |
| Entrez gene record: |
5618 |
| Havana BLAST/BLAT: |
OTTHUMG00000090789 |