Prolactin Receptor Antibody / PRLR

Contact us
Catalog number: R31984
Price: 406 €
Supplier: NJS poly
Product name: Prolactin Receptor Antibody / PRLR
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Prolactin Receptor / PRLR
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the PRLR antibody should be determined by the researcher
Intented use: This PRLR antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P16471
Purity: Antigen affinity
Description: (1989, (1990) demonstrated that zinc greatly increases the affinity of GH for the extracellular binding domain of PRLR, 1990) demonstrated that the prolactin receptor gene resides in the same chromosomal region as the growth hormone receptor gene, Arden et al, By mutational analysis, By somatic cell hybrid analysis and by in situ hybridization, Cunningham et al, although it is not required for binding of GH to the growth hormone receptor or for binding of prolactin to the prolactin receptor, and glutamic acid-174) in GH and histidine-188 in PRLR (conserved in all PRL receptors but not GH receptors) are likely zinc-ion ligands, histidine-21, they showed that a cluster of 3 residues (histidine-18, which has been mapped to 5p13-p12, PRLR (Prolactin Receptor) is a cytokine receptor
Immunogen: Amino acids HAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQ of human PRLR were used as the immunogen for the PRLR antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PRLR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Prolactin Receptor / PRLR
Short name: Prolactin Receptor Antibody / PRLR
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Prolactin Receptor (Antibody to) / prolactin receptor
Alternative technique: antibodies
Alternative to gene target: Extracellular, HPRL and hPRLrI and MFAB, PRLR and IDBG-15793 and ENSG00000113494 and 5618, PRLR and IDBG-630451 and ENSBTAG00000025035 and 281422, Prlr and IDBG-129218 and ENSMUSG00000005268 and 19116, metal ion binding, this GO :0004896 and cytokine receptor activity and molecular function this GO :0004925 and prolactin receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006694 and steroid biosynthetic process and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007171 and activation of transmembrane receptor protein tyrosine kinase activity and biological process this GO :0007259 and JAK-STAT cascade and biological process this GO :0007566 and embryo implantation and biological process this GO :0007595 and lactation and biological process this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0017046 and peptide hormone binding and molecular function this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030155 and regulation of cell adhesion and biological process this GO :0030856 and regulation of epithelial cell differentiation and biological process this GO :0031904 and endosome lumen and cellular component this GO :0038161 and prolactin signaling pathway and biological process this GO :0042110 and T cell activation and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0042977 and activation of JAK2 kinase activity and biological process this GO :0042978 and ornithine decarboxylase activator activity and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0046872 and metal ion binding and molecular function this GO :0060397 and JAK-STAT cascade involved in growth hormone signaling pathway and biological process this GO :0060644 and mammary gland epithelial cell differentiation and biological process this GO :0060736 and prostate gland growth and biological process this GO :0060749 and mammary gland alveolus development and biological process this GO :0061180 and mammary gland epithelium development and biological process, this GO :0004896 : cytokine receptor activity, this GO :0004896 : cytokine receptor activity and also this GO :0004925 : prolactin receptor activity and also this GO :0005515 : protein binding and also this GO :0017046 : peptide hormone binding and also this GO :0042803 : protein homodimerization activity and also this GO :0042978 : ornithine decarboxylase activator activity and also this GO :0046872 : metal ion binding, this GO :0004925 : prolactin receptor activity, this GO :0005515 : protein binding, this GO :0017046 : peptide hormone binding, this GO :0042803 : protein homodimerization activity, this GO :0042978 : ornithine decarboxylase activator activity, this GO :0046872 : metal ion binding, prolactin receptor
Identity: 9446
Gene: PRLR | More about : PRLR
Long gene name: prolactin receptor
Locus: 5p13, 2
Discovery year: 1989-12-01
Entrez gene record: 5618
Havana BLAST/BLAT: OTTHUMG00000090789

Related Products :