Recombinant Human PD-L1, B7-H1, CD274 (C-Flag)

Contact us
Catalog number: CM33
Price: 572 €
Supplier: adv
Product name: Recombinant Human PD-L1, B7-H1, CD274 (C-Flag)
Quantity: 20μg
Other quantities: 10 µg 115€ 50 µg 202€ 500 µg 1186€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Programmed Cell Death 1 Ligand 1 is produced by our Mammalian expression system and the target gene encoding Phe19-Thr239 is expressed with a Flag tag at the C-terminus
Molecular Weight: 26, 3 kD
UniProt number: Q9NZQ7
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 20 mM PB 150 mM sodium chloride pH 7, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTDYKDDDDK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties:  , Also separation of , Depending on the epitopes used human ELISA kits can be cross reactive to many other species, FLAGS are also used in the isolation of , For electrophorese protein detection rabbit polyclonals anti Flag conjugation are the most suited antibodies, Human proteins, It has been used to enrich proteins of height purity and quality to see the 3D crystal structure with x-ray, Mainly analyzed are human serum, Modern , Suitable for in vivo use in cells, This FLAG-tags have the sequence DYKDDDDK motiv, because its mild purification procedure tends not to disrupt such complexes, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, or , or , overexpressed proteins from cell lysates is done by FLAG go HIS tags, plasma, primarily , saliva, urine,  , (Homo sapiens, An anti-flag tag (FLAG fusion protein) is use to detect a FLAG-tag, FLAG epitope that is a polypeptide , FLAG octapeptide, Homo sapiens sapiens), These tags are very useful to do protein purification by , affinity chromatography, humans , protein complexes , protein tag , recombinant, recombinant DNA, ssp, that can be added to a protein using , with multiple subunits
Conjugation: Flag
Group: recombinants
Gene target: B7-H1, CD274 (C, PD-L1
Short name: B7-H1, CD274 (C- ), Recombinant PD-L1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Label: Flag
Species: Humans, Human
Alternative name: B7-H1, CD274 molecule (C-Flag), sapiens PD-L1, recombinant H
Alternative technique: rec
Alternative to gene target: CD274 and IDBG-47487 and ENSG00000120217 and 29126, Cd274 and IDBG-157249 and ENSMUSG00000016496 and 60533, Cell surfaces, PD-L1 and IDBG-631351 and ENSBTAG00000000095 and 533834, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0012505 and endomembrane system and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0031295 and T cell costimulation and biological process this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :2001181 and positive regulation of interleukin-10 secretion and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD274 molecule
Identity: 17635
Gene: CD274 | More about : CD274
Long gene name: CD274 molecule
Synonyms gene: PDCD1LG1
Synonyms gene name: programmed cell death 1 ligand 1 CD274 antigen
Synonyms: B7-H B7H1 PD-L1 PDL1 B7-H1
Synonyms name: B7 homolog 1
Locus: 9p24, 1
Discovery year: 2003-11-13
GenBank acession: AF177937
Entrez gene record: 29126
Pubmed identfication: 11015443 10581077
RefSeq identity: NM_014143
Classification: Endogenous ligands C2-set domain containing CD molecules V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000019503

Related Products :

CM33 Recombinant Human PD-L1, B7-H1, CD274 (C-Flag) 1 mg 1674 € novo human
GWB-767A33 HDAC-2, FLAG-tag, Active Human recombinant protein, FLAG Tag 1 tube 717 € genways human
C315 Recombinant Human PD-L1, B7-H1, CD274 (C-6His) 50 µg 171 € novo human
CM06 Recombinant Human PD-L1, B7-H1, CD274 (C-mFc) 500 µg 1186 € novo human
RP-1195H Recombinant Human PD-L1 / B7-H1 / CD274 Protein (ECD, Fc Tag) 20μg 346 € adv human
RP-1193H Recombinant Human PD-L1 / B7-H1 / CD274 Protein (Fc Tag) 100μg 624 € adv human
RP-1194H Recombinant Human PD-L1 / B7-H1 / CD274 Protein (His Tag) 100μg 624 € adv human
abx261703 Anti-CD274 Protein (Recombinant) 20 µg 340 € abbex human
abx263458 Anti-CD274 Protein (Recombinant) 100 µg 1674 € abbex human
GWB-P0495A CD274, 19-238aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-P0393C CD274, 19-239aa, Recombinant Protein bulk Ask price € genways bulk human
RP-1040RC Recombinant Cynomolgus PD-L1 / B7-H1 / CD274 Protein (Fc Tag) 100μg 659 € adv human
CJ88 Recombinant Mouse PD-L1, B7-H1, CD274 (C-6His) 1 mg 1115 € novo mouse
CJ89 Recombinant Mouse PD-L1, B7-H1, CD274 (C-Fc) 50 µg 156 € novo mouse
RP-1442M Recombinant Mouse PD-L1 / B7-H1 / CD274 Protein (His & Fc Tag) 100μg 624 € adv mouse
RP-1441M Recombinant Mouse PD-L1 / B7-H1 / CD274 Protein (His Tag) 100μg 624 € adv mouse
RP-1041RC Recombinant Rhesus PD-L1 / B7-H1 / CD274 Protein (His Tag) 100μg 659 € adv rhesus
GWB-PSB0F8 Ceramide Kinase (FLAG Tag), Active Human recombinant protein 1 vial 701 € genways human
GWB-PS1E5B HDAC-6, FLAG-tag, Active Human recombinant protein 1 vial 717 € genways human
GWB-21102D HDAC10 (FLAG) Active Human recombinant protein 1 x 1 vial 717 € genways human
GWB-568389 PDE2A (FLAG), Active Human recombinant protein 1 x 1 vial 717 € genways human
GWB-F64C10 PI3 kinase (p110a/p85a), Active Human recombinant protein FLAG tag 1 vial 701 € genways human
HER36-R-10 Recombinant (HEK) human Her2/Erbb2/Neu (1-652)-Flag tag (DDDDK) fusion protein 10 μg 478 € adi human
HER36-R-50 Recombinant (HEK) human Her2/Erbb2/Neu (1-652)-Flag tag (DDDDK) fusion protein 50 μg 1428 € adi human
CM29 Recombinant Human Brain Natriuretic Peptide, BNP (N-6His-Flag) 50 µg 369 € novo human
RP-0325H Recombinant Human CD38 Protein (His & FLAG Tag) 10μg 624 € adv human
RP-0327H Recombinant Human CD3d / CD3 delta Protein (Fc & FLAG Tag) 20μg 572 € adv human
CS47 Recombinant Human Cytotoxic T-lymphocyte Protein 4(C-Flag) 50 µg 141 € novo human
CS95 Recombinant Human D-glucuronyl C5-epimerase (N-Flag-6His) 10 µg 156 € novo human
RP-0596H Recombinant Human EGFL6 / EGF-L6 Protein (Flag & His Tag) 20μg 572 € adv human