| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse TNFRSF5 is produced by our Mammalian expression system and the target gene encoding Leu20-Arg193 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
46, 5 kD |
| UniProt number: |
P27512 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CD40L Receptor (C-Fc), TNFRSF5, CD40 |
| Short name: |
CD40L Receptor (C-Fc), TNFRSF5, Recombinant Mouse CD40 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
CD40L Receptor (C-fragment c), TNFRSF5, tumor necrosis factor receptor superfamily member 5, recombinant Mouse CD40 molecule |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, Bp50 and CDW40 and p50 and TNFRSF5, CD40 and IDBG-78904 and ENSG00000101017 and 958, Cd40 and IDBG-212533 and ENSMUSG00000017652 and 21939, Extracellular, TNF receptor superfamily member 5, this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0002768 and immune response-regulating cell surface receptor signaling pathway and biological process this GO :0003823 and antigen binding and molecular function this GO :0004871 and signal transducer activity and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006461 and protein complex assembly and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006954 and inflammatory response and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0019899 and enzyme binding and molecular function this GO :0030168 and platelet activation and biological process this GO :0030890 and positive regulation of B cell proliferation and biological process this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0032735 and positive regulation of interleukin-12 production and biological process this GO :0032855 and positive regulation of Rac GTPase activity and biological process this GO :0035631 and CD40 receptor complex and cellular component this GO :0042100 and B cell proliferation and biological process this GO :0042113 and B cell activation and biological process this GO :0042511 and positive regulation of tyrosine phosphorylation of Stat1 protein and biological process this GO :0043089 and positive regulation of Cdc42 GTPase activity and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0043406 and positive regulation of MAP kinase activity and biological process this GO :0045087 and innate immune response and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048304 and positive regulation of isotype switching to IgG isotypes and biological process this GO :0050776 and regulation of immune response and biological process this GO :0051023 and regulation of immunoglobulin secretion and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0051607 and defense response to virus and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :0090037 and positive regulation of protein kinase C signaling and biological process this GO :2000353 and positive regulation of endothelial cell apoptotic process and biological process, this GO :0003823 : antigen binding, this GO :0003823 : antigen binding and also this GO :0004871 : signal transducer activity and also this GO :0004872 : receptor activity and also this GO :0005515 : protein binding and also this GO :0019899 : enzyme binding and also this GO :0031625 : ubiquitin protein ligase binding, this GO :0004871 : signal transducer activity, this GO :0004872 : receptor activity, this GO :0005515 : protein binding, this GO :0019899 : enzyme binding, this GO :0031625 : ubiquitin protein ligase binding, ubiquitin protein ligase binding, 42498 and IDBG-643036 and ENSBTAG00000020736 and 286849, CD40 molecule |
| Identity: |
11919 |
| Gene: |
CD40 |
More about : CD40 |
| Long gene name: |
CD40 molecule |
| Synonyms gene: |
TNFRSF5 |
| Synonyms gene name: |
TNF receptor superfamily member 5 , member 5 CD40 molecule, tumor necrosis factor receptor superfamily |
| Synonyms: |
p50 Bp50 |
| Locus: |
20q13, 12 |
| Discovery year: |
1993-08-27 |
| GenBank acession: |
X60592 |
| Entrez gene record: |
958 |
| Pubmed identfication: |
7687385 2998589 |
| RefSeq identity: |
NM_001250 |
| Classification: |
CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000033053 |
| Locus Specific Databases: |
CD40base: Mutation registry for CD40 deficiency (previously known as TNFRSF5base) LRG_40 |