| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human TNFRSF5 is produced by our Mammalian expression system and the target gene encoding Glu21-Arg193 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
2 kD, 20 |
| UniProt number: |
P25942 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD40L Receptor (C-6His), TNFRSF5, CD40 |
| Short name: |
CD40L Receptor (C-6His), TNFRSF5, Recombinant CD40 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD40L Receptor (C-6His), TNFRSF5, sapiens CD40 molecule, tumor necrosis factor receptor superfamily member 5, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, Bp50 and CDW40 and p50 and TNFRSF5, CD40 and IDBG-78904 and ENSG00000101017 and 958, Cd40 and IDBG-212533 and ENSMUSG00000017652 and 21939, Extracellular, TNF receptor superfamily member 5, this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0002768 and immune response-regulating cell surface receptor signaling pathway and biological process this GO :0003823 and antigen binding and molecular function this GO :0004871 and signal transducer activity and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006461 and protein complex assembly and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006954 and inflammatory response and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0019899 and enzyme binding and molecular function this GO :0030168 and platelet activation and biological process this GO :0030890 and positive regulation of B cell proliferation and biological process this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0032735 and positive regulation of interleukin-12 production and biological process this GO :0032855 and positive regulation of Rac GTPase activity and biological process this GO :0035631 and CD40 receptor complex and cellular component this GO :0042100 and B cell proliferation and biological process this GO :0042113 and B cell activation and biological process this GO :0042511 and positive regulation of tyrosine phosphorylation of Stat1 protein and biological process this GO :0043089 and positive regulation of Cdc42 GTPase activity and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0043406 and positive regulation of MAP kinase activity and biological process this GO :0045087 and innate immune response and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048304 and positive regulation of isotype switching to IgG isotypes and biological process this GO :0050776 and regulation of immune response and biological process this GO :0051023 and regulation of immunoglobulin secretion and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0051607 and defense response to virus and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :0090037 and positive regulation of protein kinase C signaling and biological process this GO :2000353 and positive regulation of endothelial cell apoptotic process and biological process, this GO :0003823 : antigen binding, this GO :0003823 : antigen binding and also this GO :0004871 : signal transducer activity and also this GO :0004872 : receptor activity and also this GO :0005515 : protein binding and also this GO :0019899 : enzyme binding and also this GO :0031625 : ubiquitin protein ligase binding, this GO :0004871 : signal transducer activity, this GO :0004872 : receptor activity, this GO :0005515 : protein binding, this GO :0019899 : enzyme binding, this GO :0031625 : ubiquitin protein ligase binding, ubiquitin protein ligase binding, 42498 and IDBG-643036 and ENSBTAG00000020736 and 286849, CD40 molecule |
| Identity: |
11919 |
| Gene: |
CD40 |
More about : CD40 |
| Long gene name: |
CD40 molecule |
| Synonyms gene: |
TNFRSF5 |
| Synonyms gene name: |
TNF receptor superfamily member 5 , member 5 CD40 molecule, tumor necrosis factor receptor superfamily |
| Synonyms: |
p50 Bp50 |
| Locus: |
20q13, 12 |
| Discovery year: |
1993-08-27 |
| GenBank acession: |
X60592 |
| Entrez gene record: |
958 |
| Pubmed identfication: |
7687385 2998589 |
| RefSeq identity: |
NM_001250 |
| Classification: |
CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000033053 |
| Locus Specific Databases: |
CD40base: Mutation registry for CD40 deficiency (previously known as TNFRSF5base) LRG_40 |