Recombinant Mouse OX40, TNFRSF4, CD134 (C-6His)

Contact us
Catalog number: CK54
Price: 572 €
Supplier: adv
Product name: Recombinant Mouse OX40, TNFRSF4, CD134 (C-6His)
Quantity: 50μg
Other quantities: 10 µg 110€ 50 µg 232€ 500 µg 1186€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse OX40 is produced by our Mammalian expression system and the target gene encoding Val20-Pro211 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 22
UniProt number: P47741
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGPHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CD134 (C-6His), TNFRSF4, OX40
Short name: CD134 (C-6His), TNFRSF4, Recombinant Mouse OX40
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CD134 (C-6His), member 4, tumor necrosis factor receptor superfamily, recombinant Mouse OX40
Alternative technique: rec
Alternative to gene target: ACT35 and CD134 and IMD16 and OX40 and TXGP1L, Cell surfaces, DNA-templated and biological process this GO :0050710 and negative regulation of cytokine secretion and biological process this GO :0051024 and positive regulation of immunoglobulin secretion and biological process, TNFRSF4 and IDBG-635323 and ENSBTAG00000015635 and 528782, TNFRSF4 and IDBG-84605 and ENSG00000186827 and 7293, Tnfrsf4 and IDBG-208242 and ENSMUSG00000029075 and 22163, member 4, protein binding, this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0006968 and cellular defense response and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0030890 and positive regulation of B cell proliferation and biological process this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0042098 and T cell proliferation and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043433 and negative regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0045859 and regulation of protein kinase activity and biological process this GO :0045892 and negative regulation of transcription, this GO :0005031 : tumor necrosis factor-activated receptor activity, this GO :0005031 : tumor necrosis factor-activated receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, tumor necrosis factor receptor superfamily
Identity: 11918
Gene: TNFRSF4 | More about : TNFRSF4
Long gene name: TNF receptor superfamily member 4
Synonyms gene: TXGP1L
Synonyms gene name: member 4 , tumor necrosis factor receptor superfamily
Synonyms: ACT35 OX40 CD134
Locus: 1p36, 33
Discovery year: 1994-12-15
GenBank acession: X75962
Entrez gene record: 7293
Pubmed identfication: 7510240 2828930
Classification: CD molecules Tumor necrosis factor receptor superfamily
Havana BLAST/BLAT: OTTHUMG00000001415

Related Products :

CK54 Recombinant Mouse OX40, TNFRSF4, CD134 (C-6His) 1 mg 1674 € novo mouse
CK60 Recombinant Human OX40, TNFRSF4, CD134 (C-6His) 500 µg 1186 € novo human
CK52 Recombinant Mouse OX40, TNFRSF4, CD134 (C-Fc) 50 µg 232 € novo mouse
CK53 Recombinant Mouse OX40, TNFRSF4, CD134 (N-Fc) 50 µg 232 € novo mouse
RP-1565M Recombinant Mouse TNFRSF4 / OX40 / CD134 Protein (Fc Tag) 50μg 624 € adv mouse
CK58 Recombinant Human OX40, TNFRSF4, CD134 (C-Fc) 500 µg 1186 € novo human
CK59 Recombinant Human OX40, TNFRSF4, CD134 (N-Fc) 500 µg 1186 € novo human
RP-1537H Recombinant Human TNFRSF4 / OX40 / CD134 Protein (His & Fc Tag) 50μg 624 € adv human
RP-1536H Recombinant Human TNFRSF4 / OX40 / CD134 Protein (His Tag) 50μg 624 € adv human
RP-1191RC Recombinant Rhesus TNFRSF4 / OX40 / CD134 Protein (His Tag) 50μg 572 € adv rhesus
ACL040AP CD134, Mouse Monoclonal antibody- Rat; Clone: OX40, Mouse IgG2b 0.25mg 218 € accurate-monoclonals mouse
ACL040B CD134, Mouse Monoclonal antibody- Rat; Clone: OX40, Mouse IgG2b, Biotin 0.1mg 211 € accurate-monoclonals mouse
ACL040F CD134, Mouse Monoclonal antibody- Rat; Clone: OX40, Mouse IgG2b, FITC 0.1mg 211 € accurate-monoclonals mouse
ACL040PE CD134, Mouse Monoclonal antibody- Rat; Clone: OX40, Mouse IgG2b, PE 50 ug 202 € accurate-monoclonals mouse
OBT0433B CD134, OX40, activated T-Cell, Clone: MRC OX-86, Rat Mouse Monoclonal antibody-Mouse, Biotin 0.1 mg Ask price € accurate-monoclonals mouse
OBT0433F CD134, OX40, activated T-Cell, Clone: MRC OX-86, Rat Mouse Monoclonal antibody-Mouse, FITC 100 tests Ask price € accurate-monoclonals mouse
OBT0433 CD134, OX40, activated T-Cell, Clone: MRC OX-86, Rat Mouse Monoclonal antibody-Mouse; frozen, IH/flow 0.25 mg Ask price € accurate-monoclonals mouse
OBT0433R CD134, OX40, activated T-Cell, Clone: MRC OX-86, Rat Mouse Monoclonal antibody-Mouse, RPE; flow 100 tests Ask price € accurate-monoclonals mouse
YSRTMCA1420XZ CD134, OX40, Clone: MRC OX-86, Rat Mouse Monoclonal antibody-Mouse, azide-free 1.0 mg 1059 € accurate-monoclonals mouse
YSRTMCA1420B CD134, OX40, Clone: MRC OX-86, Rat Mouse Monoclonal antibody-Mouse, Biotin 0.1 mg 177 € accurate-monoclonals mouse
YSRTMCA1420F CD134, OX40, Clone: MRC OX-86, Rat Mouse Monoclonal antibody-Mouse, FITC; flow 0.1 mg 205 € accurate-monoclonals mouse
YSRTMCA1420FB CD134, OX40, Clone: MRC OX-86, Rat Mouse Monoclonal antibody-Mouse, FITC; flow 0.5 mg 519 € accurate-monoclonals mouse
YSRTMCA1420 CD134, OX40, Clone: MRC OX-86, Rat Mouse Monoclonal antibody-Mouse; flow 0.25 mg 391 € accurate-monoclonals mouse
YSRTMCA1420GA CD134, OX40, Clone: MRC OX-86, Rat Mouse Monoclonal antibody-Mouse; flow 0.1 mg 205 € accurate-monoclonals mouse
YSRTMCA1420PE CD134, OX40, Clone: MRC OX-86, Rat Mouse Monoclonal antibody-Mouse, RPE; flow vial 528 € accurate-monoclonals mouse
RCD134-B Mouse Monoclonal Anti-Rat CD134, Biotin (Clone OX40) (mouse IgG2b) 100 tests 550 € adi rat
RCD134-F Mouse Monoclonal Anti-Rat CD134, FITC (Clone OX40) (mouse IgG2b) 100 tests 550 € adi rat
RCD134-PE Mouse Monoclonal Anti-Rat CD134, PE (Clone OX40) (mouse IgG2b) 100 tests 550 € adi rat
RCD134-M Mouse Monoclonal Anti-Rat CD134, Purified (Clone OX40) (mouse IgG2b) 100 tests 565 € adi rat
RP-1137RC Recombinant Rhesus OX40 / CD134 Protein (Fc Tag) 50μg 572 € adv rhesus