| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse OX40 is produced by our Mammalian expression system and the target gene encoding Val20-Pro211 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
1 kD, 22 |
| UniProt number: |
P47741 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGPHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CD134 (C-6His), TNFRSF4, OX40 |
| Short name: |
CD134 (C-6His), TNFRSF4, Recombinant Mouse OX40 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
CD134 (C-6His), member 4, tumor necrosis factor receptor superfamily, recombinant Mouse OX40 |
| Alternative technique: |
rec |
| Alternative to gene target: |
ACT35 and CD134 and IMD16 and OX40 and TXGP1L, Cell surfaces, DNA-templated and biological process this GO :0050710 and negative regulation of cytokine secretion and biological process this GO :0051024 and positive regulation of immunoglobulin secretion and biological process, TNFRSF4 and IDBG-635323 and ENSBTAG00000015635 and 528782, TNFRSF4 and IDBG-84605 and ENSG00000186827 and 7293, Tnfrsf4 and IDBG-208242 and ENSMUSG00000029075 and 22163, member 4, protein binding, this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0006968 and cellular defense response and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0030890 and positive regulation of B cell proliferation and biological process this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0042098 and T cell proliferation and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043433 and negative regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0045859 and regulation of protein kinase activity and biological process this GO :0045892 and negative regulation of transcription, this GO :0005031 : tumor necrosis factor-activated receptor activity, this GO :0005031 : tumor necrosis factor-activated receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, tumor necrosis factor receptor superfamily |
| Identity: |
11918 |
| Gene: |
TNFRSF4 |
More about : TNFRSF4 |
| Long gene name: |
TNF receptor superfamily member 4 |
| Synonyms gene: |
TXGP1L |
| Synonyms gene name: |
member 4 , tumor necrosis factor receptor superfamily |
| Synonyms: |
ACT35 OX40 CD134 |
| Locus: |
1p36, 33 |
| Discovery year: |
1994-12-15 |
| GenBank acession: |
X75962 |
| Entrez gene record: |
7293 |
| Pubmed identfication: |
7510240 2828930 |
| Classification: |
CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000001415 |