Recombinant Mouse TACI, TNFRSF13B, CD267 (C-Fc)

Contact us
Catalog number: CJ54
Price: 336 €
Supplier: Reliatech antibodies
Product name: Recombinant Mouse TACI, TNFRSF13B, CD267 (C-Fc)
Quantity: 100ug
Other quantities: 1 mg 1674€ 10 µg 141€ 500 µg 1115€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Transmembrane Activator and CAML Interactor is produced by our Mammalian expression system and the target gene encoding Phe5-Thr129 is expressed with a Fc tag at the C-terminus
Molecular Weight: 4 kD, 41
UniProt number: Q9ET35
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MFCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCTVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CD267 (C-Fc), TNFRSF13B, TACI
Short name: CD267 (C-Fc), TNFRSF13B, Recombinant Mouse TACI
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CD267 (C-fragment c), member 13B, tumor necrosis factor receptor superfamily, recombinant Mouse TACI
Alternative technique: rec
Alternative to gene target: CD267 and CVID and CVID2 and RYZN and TACI and TNFRSF14B, Cell surfaces, TNFRSF13B and IDBG-408940 and ENSG00000240505 and 23495, TNFRSF13B and IDBG-638376 and ENSBTAG00000015298 and, Tnfrsf13b and IDBG-182161 and ENSMUSG00000010142 and 57916, member 13B, protein binding, this GO :0001782 and B cell homeostasis and biological process this GO :0002244 and hematopoietic progenitor cell differentiation and biological process this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0030889 and negative regulation of B cell proliferation and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, tumor necrosis factor receptor superfamily
Identity: 18153
Gene: TNFRSF13B | More about : TNFRSF13B
Long gene name: TNF receptor superfamily member 13B
Synonyms gene name: member 13B , tumor necrosis factor receptor superfamily
Synonyms: TACI CD267 IGAD2
Locus: 17p11, 2
Discovery year: 2002-05-22
GenBank acession: AF023614
Entrez gene record: 23495
Pubmed identfication: 9311921
Classification: CD molecules Tumor necrosis factor receptor superfamily
Havana BLAST/BLAT: OTTHUMG00000059262
Locus Specific Databases: TNFRSF13Bbase: Mutation registry for TACI deficiency LRG_120

Related Products :

CJ54 Recombinant Mouse TACI, TNFRSF13B, CD267 (C-Fc) 50 µg 303 € novo mouse
RP-1531H Recombinant Human TNFRSF13B / TACI / CD267 Protein (His Tag) 50μg 624 € adv human
GWB-BIG11E Recombinant Human TACI (TNFRSF13B) bulk Ask price € genways bulk human
AR50813PU-N anti-CD267 / TACI (1-165, His-tag) Antibody 0,5 mg 1109 € acr human
AR50813PU-S anti-CD267 / TACI (1-165, His-tag) Antibody 0,1 mg 485 € acr human
AP08485PU-N anti-CD267 / TACI (116-132) Antibody 50 Вµg 732 € acr human
AM26557AF-N anti-CD267 / TACI Antibody 0,1 mg 645 € acr human
AM26557RP-N anti-CD267 / TACI Antibody 50 Tests 572 € acr human
AP07794PU-N anti-CD267 / TACI Antibody 50 Вµg 732 € acr human
PA196 anti-CD267 / TACI Antibody 5 Вµg 253 € acr human
PA196X anti-CD267 / TACI Antibody 20 Вµg 384 € acr human
PP1218B1 anti-CD267 / TACI Antibody 25 Вµg 384 € acr human
PP1218B2 anti-CD267 / TACI Antibody 50 Вµg 543 € acr human
PP1218P1 anti-CD267 / TACI Antibody 50 Вµg 384 € acr human
PP1218P2 anti-CD267 / TACI Antibody 0,1 mg 543 € acr human
SP2135P anti-CD267 / TACI Antibody 0,1 mg 529 € acr human
AP30855CP-N anti-CD267 / TACI Control Peptide Antibody 50 Вµg 282 € acr human
MBS240310 Anti-Human TNFRSF13B / TACI 50ug 597 € MBS Polyclonals_1 human
MBS241880 PAb (IgG) to Human TNFRSF13B / TACI Antibody 50ug 597 € MBS Polyclonals_1 human
GWB-2DC935 Tumor Necrosis Factor Receptor Superfamily Member 13B (TNFRSF13B/TACI) Rabbit antibody to or anti-Human Polyclonal (aa116-132) antibody 1 x 1 vial 602 € genways human
GWB-270E8F Tumor Necrosis Factor Receptor Superfamily Member 13B (TNFRSF13B/TACI) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 x 1 vial 602 € genways human
CEK1415 anti-Mouse CD267 ELISA Kit Antibody 96 Tests 703 € acr mouse
GWB-ATG117 TNFRSF13B, 1-165aa, Human, His tag, E.coli, Recombinant Protein bulk Ask price € genways bulk human
ZR-40-308 TACI Recombinant Protein 0.005 mg 256 € Zyagen human
MBS221837 Anti-HUMAN CD267 Antibody 100ug 393 € MBS Polyclonals_1 human
CEK1089 anti-Human CD267 ELISA Kit Antibody 96 Tests 703 € acr human
GWB-4513FA CD267 antibody 1 x 1 vial 267 € genways human
GWB-C5A4D3 CD267 antibody 1 vial 470 € genways human
GENTAUR-58bde428e4240 RAT ANTI HUMAN CD267 Antibody 0.025 miligrams 249 € MBS mono human
103-M481 Anti-Mouse TNFRSF13B 100ug 336 € Reliatech antibodies mouse