| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Transmembrane Activator and CAML Interactor is produced by our Mammalian expression system and the target gene encoding Phe5-Thr129 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
4 kD, 41 |
| UniProt number: |
Q9ET35 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MFCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCTVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CD267 (C-Fc), TNFRSF13B, TACI |
| Short name: |
CD267 (C-Fc), TNFRSF13B, Recombinant Mouse TACI |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
CD267 (C-fragment c), member 13B, tumor necrosis factor receptor superfamily, recombinant Mouse TACI |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD267 and CVID and CVID2 and RYZN and TACI and TNFRSF14B, Cell surfaces, TNFRSF13B and IDBG-408940 and ENSG00000240505 and 23495, TNFRSF13B and IDBG-638376 and ENSBTAG00000015298 and, Tnfrsf13b and IDBG-182161 and ENSMUSG00000010142 and 57916, member 13B, protein binding, this GO :0001782 and B cell homeostasis and biological process this GO :0002244 and hematopoietic progenitor cell differentiation and biological process this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0030889 and negative regulation of B cell proliferation and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, tumor necrosis factor receptor superfamily |
| Identity: |
18153 |
| Gene: |
TNFRSF13B |
More about : TNFRSF13B |
| Long gene name: |
TNF receptor superfamily member 13B |
| Synonyms gene name: |
member 13B , tumor necrosis factor receptor superfamily |
| Synonyms: |
TACI CD267 IGAD2 |
| Locus: |
17p11, 2 |
| Discovery year: |
2002-05-22 |
| GenBank acession: |
AF023614 |
| Entrez gene record: |
23495 |
| Pubmed identfication: |
9311921 |
| Classification: |
CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000059262 |
| Locus Specific Databases: |
TNFRSF13Bbase: Mutation registry for TACI deficiency LRG_120 |