Recombinant Mouse Plasma Glutamate Carboxypeptidase, PGCP (C-6His)

Contact us
Catalog number: CJ09
Price: 496 €
Supplier: novo
Product name: Recombinant Mouse Plasma Glutamate Carboxypeptidase, PGCP (C-6His)
Quantity: 50 µg
Other quantities: 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Plasma glutamate carboxypeptidase is produced by our Mammalian expression system and the target gene encoding Lys19-Ser470 is expressed with a 6His tag at the C-terminus
Molecular Weight: 50, 9 kD
UniProt number: Q9WVJ3
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KAVFKNGVSQRTFREIKEEIANYEDVAKAIINLAVYGKYQNRSYERLGLLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLENVHLEQVRIPHWERGEESAVMLEPRIHKMAILGLGSSIGTPPGGITAEVLVVASFDELQRRASEARGKIIVYNQPYTGYEKTVQYRVQGAVEAAKVGAVASLIQSVASFSIYSPHTGIQKYQDGVPKIPTACITVEDAEMMSRMASRGNKIVIHLEMGAKTYPDTDSFNTVAEITGSMYPEEVVLVSGHLDSWDVGQGALDDGGGAFISWEALSLVKDLGLRPKRTLRLVLWTAEEQGGIGASQYYELHKANISKYSLVMEADSGTFLPTGLQFTGSDKARAIMKEVMNLLQPLNVTKVFSNGEGTDINFWIQAGVPGASLRDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVAYVVADMDEMLPRSVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: PGCP (C-6His), Plasma Glutamate Carboxypeptidase
Short name: PGCP (C-6His), Recombinant Mouse Plasma Glutamate Carboxypeptidase
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: PGCP (C-6His), recombinant Mouse Plasma Glutamate Carboxypeptidase
Alternative technique: rec
Identity: 16910
Gene: CPQ | More about : CPQ
Long gene name: carboxypeptidase Q
Synonyms: LDP PGCP
Synonyms name: lysosomal dipeptidase Ser-Met dipeptidase plasma glutamate carboxypeptidase
Locus: 8q22, 1
Discovery year: 2012-02-17
GenBank acession: AF107834
Entrez gene record: 10404
Pubmed identfication: 10206990
RefSeq identity: NM_016134
Classification: Carboxypeptidases
Havana BLAST/BLAT: OTTHUMG00000164690

Related Products :

CJ09 Recombinant Mouse Plasma Glutamate Carboxypeptidase, PGCP (C-6His) 500 µg 1613 € novo mouse
CJ17 Recombinant Mouse Carboxypeptidase A2, CPA2 (C-6His) 10 µg 156 € novo mouse
CJ13 Recombinant Mouse Carboxypeptidase A4, CPA4 (C-6His) 500 µg 1613 € novo mouse
C780 Recombinant Mouse Carboxypeptidase M, CPM (C-6His) 1 mg 1115 € novo mouse
C768 Recombinant Mouse Probable Carboxypeptidase PM20D1, PM20d1 (C-6His) 50 µg 496 € novo mouse
GENTAUR-58be67de83c48 Anti-PGCP (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
GWB-MR119B PGCP antibody 1 vial 521 € genways human
MBS274156 PGCP antibody 100ul 426 € MBS Polyclonals_1 human
bs-9917R-A350 PGCP Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9917R-A488 PGCP Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9917R-A555 PGCP Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9917R-A594 PGCP Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9917R-A647 PGCP Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9917R-Biotin PGCP Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-9917R PGCP Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-9917R-Cy3 PGCP Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-9917R-Cy5 PGCP Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-9917R-Cy5.5 PGCP Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-9917R-Cy7 PGCP Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-9917R-FITC PGCP Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-9917R-HRP PGCP Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
GWB-41974D PGCP Over-expression Lysate reagent 1 x 1 vial 463 € genways human
CJ20 Recombinant Human Plasma Kallikrein, KLKB1 (C-6His) 500 µg 1613 € novo human
C592 Recombinant Human Carboxypeptidase A1, CPA1 (C-6His) 50 µg 496 € novo human
C593 Recombinant Human Carboxypeptidase A2, CPA2 (C-6His) 1 mg 2283 € novo human
C594 Recombinant Human Carboxypeptidase A4, CPA4 (C-6His) 50 µg 496 € novo human
C455 Recombinant Human Carboxypeptidase B, CPB1 (C-6His) 10 µg 202 € novo human
CA32 Recombinant Human Carboxypeptidase B2, CPB2 (C-6His) 1 mg 2283 € novo human
CC57 Recombinant Human Carboxypeptidase E, CPE (C-6His) 50 µg 496 € novo human
CC58 Recombinant Human Carboxypeptidase M, CPM (C-6His) 50 µg 496 € novo human