| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Host cell factor 2 is produced by our E, coli expression system and the target gene encoding Met1-Glu497 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
2 kD, 55 |
| UniProt number: |
Q9D968 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 2MUrea, 4, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MNHKVHHHHHHMAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTVTNQWFLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPQPPPSGFPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIPATKGVVPSPRESHTAIIYCKKDSASPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGNKMYIFGGWVPHKGENPETSPHDCEWRCTSSFSYLNLDTAEWTTLVSDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAPSQVQLIKATTNSFHVKWDEVPTVEGYLLQLNTDLTYQATSSDSSAAPSVLGGRMDPHRQGSNSTLHNSVSDTVNSTKTEHTAVRGTSLRSKPDSRAVDSSAALHSPLAPNTSNNSSWVTDMLRKNE |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
HCFC2 (N-6His), Factor 2 |
| Short name: |
HCFC2 (N-6His), Recombinant Mouse Host Cell Factor 2 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
production species cellular factor complement component 2 (N-6His), recombinant Mouse production species cellular Factor 2 |
| Alternative technique: |
rec |
| Alternative to gene target: |
HCFC2 and IDBG-54267 and ENSG00000111727 and 29915, HCFC2 and IDBG-637429 and ENSBTAG00000020933 and 505341, Hcfc2 and IDBG-179766 and ENSMUSG00000020246 and 67933, nuclei, protein binding, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0003713 and transcription coactivator activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0016032 and viral process and biological process, this GO :0003713 : transcription coactivator activity, this GO :0003713 : transcription coactivator activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, host cell factor C2 |
| Identity: |
24972 |
| Gene: |
HCFC2 |
More about : HCFC2 |
| Long gene name: |
host cell factor C2 |
| Synonyms: |
HCF-2 |
| Locus: |
12q23, 3 |
| Discovery year: |
2004-06-18 |
| GenBank acession: |
AF117210 |
| Entrez gene record: |
29915 |
| Pubmed identfication: |
10196288 |
| RefSeq identity: |
NM_013320 |
| Havana BLAST/BLAT: |
OTTHUMG00000170175 |